Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.85
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.341 6.8e-03
psoriasis -1.400 2.0e-04
posterior fossa group B ependymoma -1.500 2.1e-10
medulloblastoma -1.600 3.8e-05
atypical teratoid / rhabdoid tumor -1.700 1.3e-07
glioblastoma -1.100 1.4e-06
medulloblastoma, large-cell -2.100 2.1e-06
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 6.4e-03
ovarian cancer 2.700 6.7e-07
Bipolar Disorder -1.200 3.3e-02
dermatomyositis 1.100 7.0e-03

Gene RIF (2)

PMID Text
22281740 The crystal structure at 1.75 A resolution of an apo form of human evectin-2 pleckstrin homology domain, in which the ligand-binding site is free from crystal packing and is thus appropriate for comparison with the structure of the complex, is reported.
21911378 Data show that depletion of evt-2 or masking of intracellular PS suppressed membrane traffic from REs to the Golgi.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDG      1 - 70
KSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAP     71 - 140
EQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAA    141 - 210
TGMALGSLFWVF                                                              211 - 222
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22281740 2012 Structural basis of the strict phospholipid binding specificity of the pleckstrin homology domain of human evectin-2.
21911378 2011 Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10200314 1999 Evectins: vesicular proteins that carry a pleckstrin homology domain and localize to post-Golgi membranes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.