Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.67
PubTator Score 17.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 1.4e-03
pancreatic cancer 1.100 2.9e-03
adrenocortical carcinoma 1.714 7.2e-06
intraductal papillary-mucinous neoplasm ... 2.000 1.9e-03
pancreatic carcinoma 1.100 2.9e-03
ovarian cancer 1.900 4.1e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (8)

PMID Text
25122779 Altogether, this study implies that hepatitis C virus coopts FAPP2 for virus genome replication via phosphatidylinositol 4-phosphate binding and glycosphingolipid transport to the hepatitis C virus replication complex.
22266015 FAPP2 functions in both membrane trafficking and lipid metabolism in a fashion that integrates its activities in membrane trafficking and in lipid transfer. (Review)
19940249 Data show that FAPP2 is present in tubules forming from the trans-Golgi in epithelial MDCK cells.
19341712 These data demonstrate a previously unknown role for FAPP2 in conferring resistance to apoptosis and indicate that FAPP2 may be a target for cancer therapy.
17687330 by coupling the synthesis of glycosphingolipids with their export to the cell surface, FAPP2 emerges as crucial in determining the lipid identity and composition of the plasma membrane
17116893 Data demonstrate FAPP2 is required for cilium formation in polarized MDCK cells.
16103222 FAPP2 plays a specific role in apical transport in MDCK cells.
15107860 Data show that FAPP1 and 2 are essential components of a phosphatidylinositol 4-phosphate- and ADP-ribosylation factor-regulated machinery that controls generation of constitutive post-Golgi carriers.

AA Sequence

MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTRMDLIIPGEQY      1 - 70
FYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSELRLYCDLLVQQVDKTKEVTTT     71 - 140
GVSNSEEGIDVGTLLKSTCNTFLKTLEECMQIANAAFTSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNS    141 - 210
LERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIRKEDGMENLK    211 - 280
NHDNNLTQSGSDSSCSPECLWEEGKEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLG    281 - 350
PTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLT    351 - 420
EVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPSYEDFVAALTVKEGDHQKEAFSIGMQRDL    421 - 490
SLYLPAMEKQLAILDTLYEVHGLESDEVV                                             491 - 519
//

Text Mined References (17)

PMID Year Title
25122779 2014 Modulation of hepatitis C virus genome replication by glycosphingolipids and four-phosphate adaptor protein 2.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
22266015 2012 Connecting vesicular transport with lipid synthesis: FAPP2.
20482226 2010 Gene expression profiles for predicting the efficacy of the anticancer drug 5-fluorouracil in breast cancer.
19940249 2009 Golgi protein FAPP2 tubulates membranes.
19341712 2009 FAPP2 gene downregulation increases tumor cell sensitivity to Fas-induced apoptosis.
18459163 2008 Two sphingolipid transfer proteins, CERT and FAPP2: their roles in sphingolipid metabolism.
17687330 2007 Glycosphingolipid synthesis requires FAPP2 transfer of glucosylceramide.
17116893 2006 FAPP2, cilium formation, and compartmentalization of the apical membrane in polarized Madin-Darby canine kidney (MDCK) cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16103222 2005 FAPP2 is involved in the transport of apical cargo in polarized MDCK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107860 2004 FAPPs control Golgi-to-cell-surface membrane traffic by binding to ARF and PtdIns(4)P.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.