Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.21
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.528 5.5e-03
aldosterone-producing adenoma -2.105 2.2e-02
astrocytic glioma 1.800 6.1e-03
chronic rhinosinusitis -1.311 3.5e-03
Duchenne muscular dystrophy 1.122 1.9e-05
ependymoma 2.300 2.0e-03
glioblastoma -1.300 1.2e-02
interstitial cystitis -1.100 6.9e-04
intraductal papillary-mucinous adenoma (... 2.000 2.3e-03
intraductal papillary-mucinous carcinoma... 1.800 2.0e-03
oligodendroglioma 1.600 4.8e-03
osteosarcoma 3.038 1.6e-04
ovarian cancer -1.100 8.3e-05
Pick disease 1.100 1.6e-03
pituitary cancer 1.200 2.5e-02
psoriasis -1.400 1.4e-04
Rheumatoid arthritis 1.200 4.2e-02

Gene RIF (1)

AA Sequence

MAADLNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPTGWEEAYTFEG      1 - 70
ARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPISMINEASNYNVTSDYAVHPMS     71 - 140
PVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGI    141 - 210
LGSILLPSFQIALLTSEDHINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKI    211 - 280
TSENAPTKETNNIPNHRVLIKPEIQNNQKNKEMSKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLP    281 - 350
SEYESGSACPAQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKI    351 - 420
QKGRGHEEETRGVISYQTLPRNMPSHRAQIMARYPEGYRTLPRNSKTRPESICSVTPSTHDKTLGPGAEE    421 - 490
KRRSMRDDTMWQLYEWQQRQFYNKQSTLPRHSTLSSPKTMVNISDQTMHSIPTSPSHGSIAAYQGYSPQR    491 - 560
TYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAGLTLQSVSPQSLQGKTLSQDEGRGTLYKYRP    561 - 630
EEVDIDAKLSRLCEQDKVVHALEEKLQQLHKEKYTLEQALLSASQEIEMHADNPAAIQTVVLQRDDLQNG    631 - 700
LLSTCRELSRATAELERAWREYDKLEYDVTVTRNQMQEQLDHLGEVQTESAGIQRAQIQKELWRIQDVME    701 - 770
GLSKHKQQRGTTEIGMIGSKPFSTVKYKNEGPDYRLYKSEPELTTVAEVDESNGEEKSEPVSEIETSVVK    771 - 840
GSHFPVGVVPPRAKSPTPESSTIASYVTLRKTKKMMDLRTERPRSAVEQLCLAESTRPRMTVEEQMERIR    841 - 910
RHQQACLREKKKGLNVIGASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATEIV    911 - 980
QLKETEPQNVDFSKELKKTENISYEMLFEPEPNGVNSVEMMDKERNKDKMPEDVTFSPQDETQTANHKPE    981 - 1050
EHPEENTKNSVDEQEETVISYESTPEVSRGNQTMAVKSLSPSPESSASPVPSTQPQLTEGSHFMCV       1051 - 1116
//

Text Mined References (30)

PMID Year Title