Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.97
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 2.3e-02
oligodendroglioma -1.100 4.5e-02
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
medulloblastoma, large-cell -1.400 1.0e-03
primary pancreatic ductal adenocarcinoma 1.126 3.2e-03

Gene RIF (6)

PMID Text
24462251 Binding sites on Fapp1 protein for Arf1 and phosphatidylinositol-4-phosphate minimally overlap
21454700 Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain.
21298564 We report the complete (1)H, (13)C and (15)N resonance assignments of the FAPP1-PH in its free state and those induced by PtdIns(4)P or detergent micelles.
20300118 The micelle-bound structure of the FAPP1 pleckstrin homology domain reveals how its prominent wedge independently tubulates Golgi membranes by leaflet penetration.
18187620 Knockdown of pleckstrin homology domain containing, family A, member 3 (PLEKHA3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15107860 Data show that FAPP1 and 2 are essential components of a phosphatidylinositol 4-phosphate- and ADP-ribosylation factor-regulated machinery that controls generation of constitutive post-Golgi carriers.

AA Sequence

MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH      1 - 70
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH     71 - 140
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV    141 - 210
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE    211 - 280
SRLMAKKQSESEDTLPSFSS                                                      281 - 300
//

Text Mined References (14)

PMID Year Title
24462251 2014 Interaction of Fapp1 with Arf1 and PI4P at a membrane surface: an example of coincidence detection.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21454700 2011 Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain.
21298564 2011 Secondary structure and 1H, 13C, 15N resonance assignments of the Golgi-specific PH domain of FAPP1.
20300118 2010 Structural basis of wedging the Golgi membrane by FAPP pleckstrin homology domains.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15107860 2004 FAPPs control Golgi-to-cell-surface membrane traffic by binding to ARF and PtdIns(4)P.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.