Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.72
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
osteosarcoma 3.834 9.6e-07
glioblastoma 1.100 1.3e-03
group 3 medulloblastoma -1.200 4.8e-02
medulloblastoma, large-cell -2.000 1.4e-03
juvenile dermatomyositis 1.095 4.1e-09
primary pancreatic ductal adenocarcinoma 1.679 2.4e-03
tuberculosis -1.100 7.3e-06
diabetes mellitus -1.600 1.1e-02
Breast cancer -2.700 3.7e-02
pediatric high grade glioma 1.300 5.5e-04
pilocytic astrocytoma 1.600 3.5e-05
primary Sjogren syndrome 1.500 8.5e-03
aldosterone-producing adenoma -1.058 3.2e-02
acute myeloid leukemia 1.300 1.6e-02
ulcerative colitis 2.300 7.0e-07
ovarian cancer -2.000 1.4e-06
pancreatic cancer 1.500 2.8e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (3)

PMID Text
23460911 This study identified TAPP2 as a novel regulator of malignant B cell migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19786618 These findings identify TAPP2 as a novel link between PI3K signaling and the cytoskeleton with potential relevance for leukemia progression.

AA Sequence

MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQLTYISKVSIA      1 - 70
TPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEK     71 - 140
KPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYCVKQGN    141 - 210
VRKSWKRRFFALDDFTICYFKCEQDREPLRTIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQA    211 - 280
DSPEDMHSWIKEIGAAVQALKCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSV    281 - 350
ASSWQPWTPVPQAGEKLLPPGDTSEDSLFTPRPGEGAPPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI    351 - 420
RTSDV                                                                     421 - 425
//

Text Mined References (13)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23460911 2013 The tandem PH domain-containing protein 2 (TAPP2) regulates chemokine-induced cytoskeletal reorganization and malignant B cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19786618 2009 TAPP2 links phosphoinositide 3-kinase signaling to B-cell adhesion through interaction with the cytoskeletal protein utrophin: expression of a novel cell adhesion-promoting complex in B-cell leukemia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14516276 2003 Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.