Property Summary

NCBI Gene PubMed Count 109
PubMed Score 319.30
PubTator Score 236.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.700 4.7e-03
ependymoma 2.800 2.5e-03
oligodendroglioma 2.500 1.1e-03
osteosarcoma 1.400 1.2e-02
glioblastoma 1.100 3.4e-02
non-small cell lung cancer 1.053 2.1e-06
active Crohn's disease -1.446 3.3e-03
pancreatic cancer 1.400 2.3e-04
COPD -1.300 2.6e-02

 GO Process (1)

Protein-protein Interaction (2)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1817 confirmatory 50 / 0 / 292433 uHTS identification of small molecule antagonists of the binding of Siah-1 and a peptide ligand via a fluorescence polarization assay.
1826 summary 0 / 0 / 0 Summary small molecule antagonists of the binding of Siah-1 and a peptide ligand via a fluorescence polarization assay.
2127 confirmatory 8 / 0 / 144 HTS fluorescence polarization-based dose response confirmatory screen for the Siah-1 primary assay utilizing an alternative fluorophore, fluorescein-labeled plectin
2141 confirmatory 61 / 0 / 91 HTS TR-FRET-based dose response confirmatory assay for Siah-1

Gene RIF (44)

PMID Text
26527396 data demonstrate that plectin is an essential regulator of nuclear morphology in vitro and in vivo and protects the nucleus from mechanical deformation.
25712130 The dominant expression of the P1a isoform in epidermal basal cell layer and cultured keratinocytes suggests that mutations in the first exon of isoform 1a cause skin-only epidermolysis bullosa simplex without extracutaneous involvement.
25556389 Report of a non-consanguineous Iranian family with two affected sisters showing limb-girdle muscular dystrophy and myasthenic symptoms without any skin involvement, caused by plectinopathy.
24940650 plectin interacts with keratins 5 and 14 in a process associated with epidermolysis bullosa simplex
24218614 Mislocated Plectin is necessary for exosome formation and produces exosomes that are capable of promoting pancreatic tumor growth and aggression.
23921385 the potential importance of the endophilin B2-plectin complex in the biological functions depending on nuclear migration and positioning.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of plectin (PLEC) expression by HIV-1 Vpr in Vpr transduced macrophages
23774525 Six of sicteen epidermolysis bullosa simplex probands had dominant PLEC missense mutations.
23717685 this study is the first to demonstrate that up-regulation of vimentin and plectin expression positively correlates with the invasion and metastasis of androgen-independent PCA
23289980 results confirm epidermolysis bullosa simplex-pyloric atresia is linked to mutations in distal exons 1-30 and 32 of PLEC; while epidermolysis bullosa simplex-muscular dystrophy is linked to PLEC mutations in all exons, in most cases one of the mutations affects exon 31
22333906 A linker region in the COOH-terminal end and serine residue at position 4645 may be important for the binding of plectin to intermediate filaments.
22245045 findings suggest that plectin promotes the migration and invasion of head and neck squamous cell carcinoma (HNSCC) cells through activation of Erk 1/2 kinase and is a potential prognostic biomarker of HNSCC.
22240165 The novel FUS-plectin interaction offers new perspectives for understanding the role of FUS and plectin mutations in the pathogenesis of FUS associated diseases
21821021 plectin participates in actin assembly and invasiveness in carcinoma cells in an isoform-specific manner
21743296 novel esophageal squamous cell carcinoma marker plectin 1 was identified by mass spectrometry and immunohistochemical analysis
21469503 plectin expression was deficient in hepatocellular carcinoma and was probably through post-translational modification
21424933 plectin deficiency might play an important role in the transformation of human liver cells
21420381 degradation of plectin induced by staurosporine-treatment in liver cells resulted in cytoskeleton disruption and induced morphological changes in these cells by affecting the expression and organization of cytokeratin 18.
21288893 The structure of the plakin domain of plectin reveals a non-canonical SH3 domain interacting with its fourth spectrin repeat.
21175599 mutational analysis of PLEC1 revealed a homozygous 36 nucleotide insertion (1506_1507ins36) that results in a reduced expression of PLEC1 mRNA and plectin in patients with epidermolysis bullosa simplex and congenital myasthenic syndrome.
21109228 data show that isoform 1f of plectin plays a key role in skeletal muscle function and that disruption of the plectin 1f can cause the LGMD2 phenotype without any dermatologic component as was previously reported with mutations in constant exons of PLEC
20665883 Plectin deficiency can indeed lead to both muscular dystrophy and pyloric atresia in an individual epidermolysis bullosa simplex (EBS) patient.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20447487 Autosomal recessive forms of epidermolysis bullosa simplex associated with extracutaneous manifestations, such as muscular dystrophy (MIM 226670) or pyloric atresia (MIM 612138), have been linked to genetic mutations in the gene for plectin
20052759 Plectin expression patterns determine two distinct subtypes of epidermolysis bullosa simplex
20016501 missense mutation causes structure of plectin amino terminus alteration so binding to actin and costameric proteins are attenuated
19709076 BRCA2-plectin interaction plays an important role in the regulation of centrosome localization and also that displacement of the centrosome may result in genomic instability and cancer development.
19366731 Data show that intermediate filament recruitment to focal adhesions in endothelial cells requires beta3 integrin, plectin and the microtubule cytoskeleton, and is dependent on microtubule motors.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18155192 Thus, plectin appears to interact with CXCR4 and plays an important role in CXCR4 signaling and trafficking and HIV-1 infection.
18084872 results reveal that plectin is up-regulated in colorectal adenocarcinoma as well as in bizarre glands and locally invasive tumor nests in tubular adenoma, compared with normal colorectal mucosa
17662978 A novel functional co-localisation is identified between two plakin cytolinker proteins.
17515952 PLEC1 was differeentially expressed in sclerotic hippocampi compared to non-sclerotic ones.
17397861 Results describe the crystal structure of an N-terminal fragment of the plakin domain of plectin to 2.05 A resolution.
16507904 Co-localization, co-immunoprecipitation, and in vitro overlay analyses demonstrated direct interaction of plectin and GFAP.
15817481 the CH1 domain of the plectin-ABD associates with the groove between the two FNIII domains of beta4
15810881 discussion of phenotypic spectrum of plectin mutations [review]
15654962 homozygous mutations in the plectin gene (PLEC1)in epidermolysis bullosa with pyloric atresia
15500642 the involvement of desmoplakin (DP), plectin, and periplakin in the destruction of epithelial cell integrity ensures the efficient elimination of cytoskeleton, but also provides specificity for selectively targeting individual adhesion molecules
14966116 propose a previously unrecognized function of plectin as cytoskeletal regulator of PKC signaling (dislocation of PKCdelta and elevated enzymatic activity), and possibly other signaling events, through sequestration of the scaffolding protein RACK1
12791251 Data report the crystal structure of the actin binding domain of plectin and show that this region is sufficient for interaction with F-actin or the cytoplasmic region of integrin alpha6beta4.
12136158 The structure was solved by the molecular-replacement method. In addition, the preparation of selenomethionine-derivative crystals is described.
11441066 During polarization of peripheral blood T lymphocytes, plectin redistributes to the uropod associated with vimentin and fodrin. This vimentin-plectin-fodrin complex provides a continuous linkage from the nucleus (lamin B) to the cortical cytoskeleton.
11172097 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of plectin (PLEC) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRETFAWCHF      1 - 70
YWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLGSPPKRGPLPTEEQRVY     71 - 140
RRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDG    141 - 210
HNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILH    211 - 280
FQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQ    281 - 350
TNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRWQE    351 - 420
YRELVLLLLQWMRHHTAAFEERRFPSSFEEIEILWSQFLKFKEMELPAKEADKNRSKGIYQSLEGAVQAG    421 - 490
QLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQMEAGLCEEQLNQADALLQSDV    491 - 560
RLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLK    561 - 630
AGVAAPATQVAQVTLQSVQRRPELEDSTLRYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQ    631 - 700
SIEEFRAKIERARSDEGQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLN    701 - 770
EKEEEEVGFDWSDRNTNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQ    771 - 840
WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDLLQDAQDEKEQ    841 - 910
LNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVCDYKQVEVTVHKGDECQLVGPAQPSHWKVLS    911 - 980
SSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLWHQLHVDMKSLLAWQSLRRDVQLIRSWSLAT    981 - 1050
FRTLKPEEQRQALHSLELHYQAFLRDSQDAGGFGPEDRLMAEREYGSCSHHYQQLLQSLEQGAQEESRCQ   1051 - 1120
RCISELKDIRLQLEACETRTVHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLAL   1121 - 1190
PEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLKEAQAVPATLP   1191 - 1260
ELEATKASLKKLRAQAEAQQPTFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLA   1261 - 1330
QTDVRQRELEQLGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQAVREQLRQEQALLEEIERHGE   1331 - 1400
KVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTHYSELTTLTSQY   1401 - 1470
IKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEEVVR   1471 - 1540
REEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEG   1541 - 1610
ELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQALEELRL   1611 - 1680
QAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERR   1681 - 1750
AQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQA   1751 - 1820
VRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQREAAAATQKRQEL   1821 - 1890
EAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEED   1891 - 1960
AARQRAEAERVLAEKLAAIGEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEE   1961 - 2030
RLAQLRKASDSELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKE   2031 - 2100
QAELEAARQRQLAAEEERRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESA   2101 - 2170
RQLQLAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDQLRGEAEAARRAAEEAEEARVQAERE   2171 - 2240
AAQSRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAADAEMEKHKKF   2241 - 2310
AEQTLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEELFSVRVQMEELSKL   2311 - 2380
KARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLK   2381 - 2450
EKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAE   2451 - 2520
RLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIA   2521 - 2590
ELEREKEKLQQEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLLQRERFIEQEKAKLEQLFQDE   2591 - 2660
VAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAEEGVRRKQEELQQLEQQRRQQEELLAEENQR   2661 - 2730
LREQLQLLEEQHRAALAHSEEVTASQVAATKTLPNGRDALDGPAAEAEPEHSFDGLRRKVSAQRLQEAGI   2731 - 2800
LSAEELQRLAQGHTTVDELARREDVRHYLQGRSSIAGLLLKATNEKLSVYAALQRQLLSPGTALILLEAQ   2801 - 2870
AASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGI   2871 - 2940
RLLEAQIATGGVIDPVHSHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVE   2941 - 3010
DPETGLCLLPLTDKAAKGGELVYTDSEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLR   3011 - 3080
QFRTGRITVEKIIKIIITVVEEQEQKGRLCFEGLRSLVPAAELLESRVIDRELYQQLQRGERSVRDVAEV   3081 - 3150
DTVRRALRGANVIAGVWLEEAGQKLSIYNALKKDLLPSDMAVALLEAQAGTGHIIDPATSARLTVDEAVR   3151 - 3220
AGLVGPEFHEKLLSAEKAVTGYRDPYTGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVP   3221 - 3290
LDVACARGCLDEETSRALSAPRADAKAYSDPSTGEPATYGELQQRCRPDQLTGLSLLPLSEKAARARQEE   3291 - 3360
LYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEKVIKILITIVE   3361 - 3430
EVETLRQERLSFSGLRAPVPASELLASGVLSRAQFEQLKDGKTTVKDLSELGSVRTLLQGSGCLAGIYLE   3431 - 3500
DTKEKVSIYEAMRRGLLRATTAALLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEQLLSAEKAV   3501 - 3570
TGYRDPYSGSTISLFQAMQKGLVLRQHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFSEEMNRVLA   3571 - 3640
DPSDDTKGFFDPNTHENLTYRQLLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEETRRAFEETQID   3641 - 3710
IPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYV   3711 - 3780
RRRLTAEDLFEARIISLETYNLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQTLSIYQALKKG   3781 - 3850
LLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLF   3851 - 3920
QAMKKELIPTEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDE   3921 - 3990
RLSYTQLLRRCRRDDGTGQLLLPLSDARKLTFRGLRKQITMEELVRSQVMDEATALQLREGLTSIEEVTK   3991 - 4060
NLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRM   4061 - 4130
GIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPV   4131 - 4200
EVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSK   4201 - 4270
SSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQY   4271 - 4340
DIDDAIAKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAVSRTQLASWSDP   4341 - 4410
TEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVDK   4411 - 4480
IMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQ   4481 - 4550
RGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGS   4551 - 4620
GSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGSSASLGGPESAVA         4621 - 4684
//

Text Mined References (127)

PMID Year Title
27234031 2016 Improved diagnostic yield of neuromuscular disorders applying clinical exome sequencing in patients arising from a consanguineous population.
26527396 2015 The cytolinker plectin regulates nuclear mechanotransduction in keratinocytes.
26477546 2015 Joubert Syndrome in French Canadians and Identification of Mutations in CEP104.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712130 2015 Mutation in exon 1a of PLEC, leading to disruption of plectin isoform 1a, causes autosomal-recessive skin-only epidermolysis bullosa simplex.
25556389 2015 Report of a patient with limb-girdle muscular dystrophy, ptosis and ophthalmoparesis caused by plectinopathy.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24940650 2014 Interaction of plectin with keratins 5 and 14: dependence on several plectin domains and keratin quaternary structure.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218614 2013 Unexpected gain of function for the scaffolding protein plectin due to mislocalization in pancreatic cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23921385 2013 The Bin/amphiphysin/Rvs (BAR) domain protein endophilin B2 interacts with plectin and controls perinuclear cytoskeletal architecture.
23774525 2014 Plectin mutations underlie epidermolysis bullosa simplex in 8% of patients.
23717685 2013 Variable metastatic potentials correlate with differential plectin and vimentin expression in syngeneic androgen independent prostate cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23289980 2013 Epidermolysis bullosa simplex with PLEC mutations: new phenotypes and new mutations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22333906 2012 Interaction of plectin and intermediate filaments.
22245045 2012 Plectin promotes migration and invasion of cancer cells and is a novel prognostic marker for head and neck squamous cell carcinoma.
22240165 2012 Fused in sarcoma (FUS) interacts with the cytolinker protein plectin: implications for FUS subcellular localization and function.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21821021 2011 Plectin regulates invasiveness of SW480 colon carcinoma cells and is targeted to podosome-like adhesions in an isoform-specific manner.
21743296 2011 Quantitative tissue proteomics of esophageal squamous cell carcinoma for novel biomarker discovery.
21469503 Pleomorphism of cancer cells with the expression of plectin and concept of filament bundles in human hepatocellular carcinoma.
21424933 2011 Plectin deficiency on cytoskeletal disorganization and transformation of human liver cells in vitro.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21420381 2011 Cytokeratin 18-mediated disorganization of intermediate filaments is induced by degradation of plectin in human liver cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21288893 2011 The structure of the plakin domain of plectin reveals a non-canonical SH3 domain interacting with its fourth spectrin repeat.
21269460 2011 Initial characterization of the human central proteome.
21263134 2011 Myasthenic syndrome caused by plectinopathy.
21223964 2011 Novel interactions of ankyrins-G at the costameres: the muscle-specific Obscurin/Titin-Binding-related Domain (OTBD) binds plectin and filamin C.
21175599 2011 Congenital myasthenic syndrome associated with epidermolysis bullosa caused by homozygous mutations in PLEC1 and CHRNE.
21109228 2010 Mutation in exon 1f of PLEC, leading to disruption of plectin isoform 1f, causes autosomal-recessive limb-girdle muscular dystrophy.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20665883 2010 Plectin deficiency leads to both muscular dystrophy and pyloric atresia in epidermolysis bullosa simplex.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20447487 2010 Epidermolysis bullosa simplex with muscular dystrophy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20052759 2010 Plectin expression patterns determine two distinct subtypes of epidermolysis bullosa simplex.
20016501 2010 PLEC1 mutations underlie adult-onset dilated cardiomyopathy in epidermolysis bullosa simplex with muscular dystrophy.
19945614 2010 Plectin gene defects lead to various forms of epidermolysis bullosa simplex.
19932097 2010 BPAG1 isoform-b: complex distribution pattern in striated and heart muscle and association with plectin and alpha-actinin.
19709076 2009 BRCA2 interacts with the cytoskeletal linker protein plectin to form a complex controlling centrosome localization.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19366731 2009 Recruitment of vimentin to the cell surface by beta3 integrin and plectin mediates adhesion strength.
19242489 2009 Structural basis of the interaction between integrin alpha6beta4 and plectin at the hemidesmosomes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18827015 2008 TorsinA binds the KASH domain of nesprins and participates in linkage between nuclear envelope and cytoskeleton.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541706 2008 Plectin isoform 1b mediates mitochondrion-intermediate filament network linkage and controls organelle shape.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18155192 2008 Plectin regulates the signaling and trafficking of the HIV-1 co-receptor CXCR4 and plays a role in HIV-1 infection.
18084872 2004 An early evaluation of malignant tendency with plectin expression in human colorectal adenoma and adenocarcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17662978 2007 Cytolinker cross-talk: periplakin N-terminus interacts with plectin to regulate keratin organisation and epithelial migration.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17515952 Gene expression in temporal lobe epilepsy is consistent with increased release of glutamate by astrocytes.
17499243 2007 Plakins in development and disease.
17397861 2007 The structure of a tandem pair of spectrin repeats of plectin reveals a modular organization of the plakin domain.
17389230 2007 Plectin 1f scaffolding at the sarcolemma of dystrophic (mdx) muscle fibers through multiple interactions with beta-dystroglycan.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16757171 2006 Current insights into the formation and breakdown of hemidesmosomes.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16507904 2006 Plectin regulates the organization of glial fibrillary acidic protein in Alexander disease.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15817481 2005 Modeling and experimental validation of the binary complex of the plectin actin-binding domain and the first pair of fibronectin type III (FNIII) domains of the beta4 integrin.
15810881 2005 Progress in epidermolysis bullosa: the phenotypic spectrum of plectin mutations.
15654962 2005 Plectin gene mutations can cause epidermolysis bullosa with pyloric atresia.
15635413 2005 Nucleolar proteome dynamics.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15500642 2004 Plakin proteins are coordinately cleaved during apoptosis but preferentially through the action of different caspases.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14966116 2004 Plectin-RACK1 (receptor for activated C kinase 1) scaffolding: a novel mechanism to regulate protein kinase C activity.
14675180 2003 Identification of a lethal form of epidermolysis bullosa simplex associated with a homozygous genetic mutation in plectin.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14559777 2003 Plectin 5'-transcript diversity: short alternative sequences determine stability of gene products, initiation of translation and subcellular localization of isoforms.
12802069 2003 Interaction of the bullous pemphigoid antigen 1 (BP230) and desmoplakin with intermediate filaments is mediated by distinct sequences within their COOH terminus.
12791251 2003 Structural and functional analysis of the actin binding domain of plectin suggests alternative mechanisms for binding to F-actin and integrin beta4.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12542521 2003 Plectin-isoform-specific rescue of hemidesmosomal defects in plectin (-/-) keratinocytes.
12482924 2003 Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136158 2002 Purification, crystallization and preliminary X-ray analysis of the plectin actin-binding domain.
11854008 2002 Plakins: a family of versatile cytolinker proteins.
11851880 2002 A site-specific plectin mutation causes dominant epidermolysis bullosa simplex Ogna: two identical de novo mutations.
11441066 2001 Cutting edge: integration of human T lymphocyte cytoskeleton by the cytolinker plectin.
11328943 2001 Epidermolysis bullosa with congenital pyloric atresia: novel mutations in the beta 4 integrin gene (ITGB4) and genotype/phenotype correlations.
11172097 2001 Fully functional, naturally occurring and C-terminally truncated variant human immunodeficiency virus (HIV) Vif does not bind to HIV Gag but influences intermediate filament structure.
11159198 2001 A compound heterozygous one amino-acid insertion/nonsense mutation in the plectin gene causes epidermolysis bullosa simplex with plectin deficiency.
10891503 2000 Identification of the cytolinker plectin as a major early in vivo substrate for caspase 8 during CD95- and tumor necrosis factor receptor-mediated apoptosis.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10780662 2000 Association of plectin with Z-discs is a prerequisite for the formation of the intermyofibrillar desmin cytoskeleton.
10637308 2000 The N terminus of the transmembrane protein BP180 interacts with the N-terminal domain of BP230, thereby mediating keratin cytoskeleton anchorage to the cell surface at the site of the hemidesmosome.
10556294 1999 Unusual 5' transcript complexity of plectin isoforms: novel tissue-specific exons modulate actin binding activity.
10525545 1999 Binding of integrin alpha6beta4 to plectin prevents plectin association with F-actin but does not interfere with intermediate filament binding.
10446808 1999 Myopathy, myasthenic syndrome, and epidermolysis bullosa simplex due to plectin deficiency.
9808630 1998 Not just scaffolding: plectin regulates actin dynamics in cultured cells.
9701547 1998 Role of plectin in cytoskeleton organization and dynamics.
9177781 1997 Plectin transcript diversity: identification and tissue distribution of variants with distinct first coding exons and rodless isoforms.
8941634 1996 A homozygous nonsense mutation in the PLEC1 gene in patients with epidermolysis bullosa simplex with muscular dystrophy.
8895530 1996 A pancreatic cancer-specific expression profile.
8894687 1996 Homozygous deletion mutations in the plectin gene (PLEC1) in patients with epidermolysis bullosa simplex associated with late-onset muscular dystrophy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8830774 1996 Basic amino acid residue cluster within nuclear targeting sequence motif is essential for cytoplasmic plectin-vimentin network junctions.
8698233 1996 Loss of plectin causes epidermolysis bullosa with muscular dystrophy: cDNA cloning and genomic organization.
8696340 1996 Plectin deficiency results in muscular dystrophy with epidermolysis bullosa.
8636409 1996 Defective expression of plectin/HD1 in epidermolysis bullosa simplex with muscular dystrophy.
8633055 1996 Human plectin: organization of the gene, sequence analysis, and chromosome localization (8q24).
8626512 1996 Identification of plectin as a substrate of p34cdc2 kinase and mapping of a single phosphorylation site.
3027087 1987 Plectin and IFAP-300K are homologous proteins binding to microtubule-associated proteins 1 and 2 and to the 240-kilodalton subunit of spectrin.
2023931 1991 Protein kinase A- and protein kinase C-regulated interaction of plectin with lamin B and vimentin.