Property Summary

NCBI Gene PubMed Count 7
PubMed Score 22.14
PubTator Score 7.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer 1.100 8.1e-03
osteosarcoma -2.902 2.7e-06
pancreatic carcinoma 1.100 8.1e-03

Protein-protein Interaction (1)

Gene RIF (4)

PMID Text
26711011 Propose that MIGA proteins promote mitochondrial fusion by regulating mitochondrial phospholipid metabolism via MitoPLD.
22281006 MitoPLD performs a critical function in a pathway that creates a specialized form of RNAi required by developing spermatocytes to suppress transposon mobilization during meiosis.
21397848 Data suggest that mitochondrial-surface phosphatidic acid generated by MitoPLD/Zuc recruits or activates nuage components critical for piRNA production.
17028579 PLD6, aka MitoPLD, encodes an N-terminal mitochondrial localization sequence, localizes to the outer mitochondrial surface, generates phosphatidic acid, a signaling lipid, and triggers trans-mitochondrial association; involved in mitochondrial fusion.

AA Sequence

MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREALFFPSQVTCTEALLRAPGAELAELPEGCP      1 - 70
CGLPHGESALSRLLRALLAARASLDLCLFAFSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLR     71 - 140
KAGIQVRHDQDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLEEFERIWEQFN    141 - 210
PTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSESQT                                211 - 252
//

Text Mined References (10)

PMID Year Title
26711011 2016 Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.
24599962 2014 Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics.
22281006 2012 Roles for the lipid-signaling enzyme MitoPLD in mitochondrial dynamics, piRNA biogenesis, and spermatogenesis.
21397848 2011 piRNA-associated germline nuage formation and spermatogenesis require MitoPLD profusogenic mitochondrial-surface lipid signaling.
21397847 2011 MITOPLD is a mitochondrial protein essential for nuage formation and piRNA biogenesis in the mouse germline.
17028579 2006 A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.