Property Summary

NCBI Gene PubMed Count 22
PubMed Score 59.98
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.200 2.5e-05
psoriasis 1.200 6.4e-04
astrocytoma -1.400 6.7e-21
oligodendroglioma -1.700 2.6e-23
osteosarcoma 1.193 2.3e-02
posterior fossa group B ependymoma -1.500 3.6e-07
intraductal papillary-mucinous neoplasm ... -1.200 3.0e-04
group 3 medulloblastoma -1.300 3.3e-02
ovarian cancer 1.900 4.2e-06

 GO Process (1)

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
26411346 Rare Variants in PLD3 Do Not Affect Risk for Early-Onset Alzheimer Disease in a European Consortium Cohort
26402410 one PLD3 variant (rs11667768) was associated with amyloid burden detected by CSF in normal individuals, suggesting the potential role of PLD3 in Abeta pathology
24866402 The rare coding variant might not play an important role in AD risk in mainland China.
24336208 genetic and functional data indicate that carriers of PLD3 coding variants have a twofold increased risk for late-onset Alzheimer's disease and that PLD3 influences APP processing
21752829 PLD3 localizes to lysosomes
20112697 PLD3 overexpression may inhibit Akt phosphorylation and further block the transduction of insulin signaling in C2C12 cells.
19525236 receptor stimulation leads to sequestration of recycling endosomes in a classical protein kinase C- and phospholipase D-dependent manner
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16580565 Our data do not support the hypothesis that the HindIII(+/-) site of the Y chromosome is a marker of cardiovascular risk in white men, highlighting the need for replication in genetic association studies.

AA Sequence

MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGP      1 - 70
NQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPS     71 - 140
AQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQT    141 - 210
HFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPME    211 - 280
ICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLR    281 - 350
RATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYM    351 - 420
VTERATYIGTSNWSGNYFTETAGTSLLVTQNGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL    421 - 490
//

Text Mined References (31)

PMID Year Title
26411346 2015 Rare Variants in PLD3 Do Not Affect Risk for Early-Onset Alzheimer Disease in a European Consortium Cohort.
26402410 2015 Common Variants in PLD3 and Correlation to Amyloid-Related Phenotypes in Alzheimer's Disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25832413 2015 PLD3 gene variants and Alzheimer's disease.
25832411 2015 PLD3 in non-familial Alzheimer's disease.
25832410 2015 PLD3 variants in population studies.
25832409 2015 Cruchaga & Goate reply.
25832408 2015 PLD3 and sporadic Alzheimer's disease risk.
24866402 2014 Investigation of TREM2, PLD3, and UNC5C variants in patients with Alzheimer's disease from mainland China.
24336208 2014 Rare coding variants in the phospholipase D3 gene confer risk for Alzheimer's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
21269460 2011 Initial characterization of the human central proteome.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20112697 2009 [Over-expression of phospholipase D3 inhibits Akt phosphorylation in C2C12 myoblasts].
19525236 2009 Sustained receptor stimulation leads to sequestration of recycling endosomes in a classical protein kinase C- and phospholipase D-dependent manner.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
16580565 2006 HindIII(+/-) polymorphism of the Y chromosome, blood pressure, and serum lipids: no evidence of association in three white populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15794758 2005 Hu-K4 is a ubiquitously expressed type 2 transmembrane protein associated with the endoplasmic reticulum.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9813063 1998 Expression of a novel murine phospholipase D homolog coincides with late neuronal development in the forebrain.
9140189 1997 A human homolog of the vaccinia virus HindIII K4L gene is a member of the phospholipase D superfamily.