Property Summary

NCBI Gene PubMed Count 36
PubMed Score 137.59
PubTator Score 52.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
SPERMATOGENIC FAILURE 17 1 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.3e-16
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Melanoma 689 0.0 0.6
Skin cancer 451 0.0 0.5
Disease Target Count Z-score Confidence
Male infertility 199 5.656 2.8
Infertility 176 5.269 2.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.3e-16

Protein-protein Interaction (6)

Gene RIF (30)

AA Sequence

MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEFRAIYRIITHR      1 - 70
EEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPIEEVRKAHQMSLEGFTRYMDS     71 - 140
RECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLLGPSDLWGYVSALVKGCRCLEIDCWDGAQNE    141 - 210
PVVYHGYTLTSKLLFKTVIQAIHKYAFMTSDYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDF    211 - 280
PDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALS    281 - 350
DLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP    351 - 420
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLIS    421 - 490
GIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQG    491 - 560
LIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR                          561 - 608
//

Text Mined References (38)

PMID Year Title