Property Summary

NCBI Gene PubMed Count 26
PubMed Score 167.93
PubTator Score 66.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -2.100 2.0e-04
aldosterone-producing adenoma -1.453 1.6e-02
astrocytic glioma -1.500 4.4e-02
Astrocytoma, Pilocytic -1.900 2.6e-09
atypical teratoid / rhabdoid tumor -2.400 2.2e-04
Breast cancer 2.500 3.0e-02
colon cancer -1.700 1.2e-02
Down syndrome 1.200 1.5e-03
Endometriosis -1.106 1.8e-02
ependymoma -2.700 2.7e-02
Gaucher disease type 3 -1.300 3.6e-03
glioblastoma -1.400 1.9e-03
group 3 medulloblastoma -1.400 2.9e-02
head and neck cancer -1.200 4.9e-02
lung adenocarcinoma -1.200 4.6e-16
lung cancer -2.600 1.2e-05
lung carcinoma 1.100 4.6e-08
malignant mesothelioma -3.300 6.5e-07
medulloblastoma, large-cell -3.600 2.7e-06
oligodendroglioma -1.500 3.6e-02
osteosarcoma -1.133 7.2e-04
ovarian cancer -1.500 3.5e-08
primitive neuroectodermal tumor -1.200 2.3e-02
progressive supranuclear palsy -1.100 3.9e-02
subependymal giant cell astrocytoma -2.851 6.2e-03
tuberculosis and treatment for 6 months 1.300 1.1e-03

Gene RIF (10)

AA Sequence

MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVALPGAAGTPADSEAGLLEAAR      1 - 70
ATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTD     71 - 140
LQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADV    141 - 210
ANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKI    211 - 280
RLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE    281 - 350
DICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIED    351 - 420
QFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILC    421 - 490
LGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDPDVLEGEVTDEDE    491 - 560
EAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPED    561 - 630
FVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIM    631 - 700
RDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQ    701 - 770
QNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVT    771 - 840
LFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVS    841 - 910
IKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAIPDVQKKMLTAYDLMIQESRF    911 - 980
LIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIE    981 - 1050
NMKQIQLACLSCGLSKAPSSSAEAKSKRSLEAIEEKESSEENGKL                            1051 - 1095
//

Text Mined References (36)

PMID Year Title