Property Summary

NCBI Gene PubMed Count 103
PubMed Score 233.16
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.900 7.7e-07
osteosarcoma -2.545 2.2e-05
colon cancer -1.100 3.7e-02
lung cancer -2.900 4.1e-03
interstitial cystitis 1.800 8.0e-04
primary Sjogren syndrome 1.600 4.9e-04
subependymal giant cell astrocytoma 1.349 9.3e-03
nasopharyngeal carcinoma -1.100 4.6e-03
lung carcinoma -1.500 3.4e-26
spina bifida 1.084 3.6e-02
ulcerative colitis 1.500 2.3e-03

Gene RIF (49)

PMID Text
25972157 Characterization of the effect of missense point-mutation at R665W in PLCG2 on signaling mechanisms of ibrutinib resistance in chronic lymphocytic leukemia cells.
25349203 PLCG2 missense mutation is a risk factor in the development of steroid sensitive nephrotic syndrome in childhood.
25227611 The autoinhibitory C-terminal SH2 domain of phospholipase C-gamma2 stabilizes B cell receptor signalosome assembly.
25012946 Data show that phospholipase Cgamma2 (PLCgamma2) is strongly expressed in B cell non-Hodgkin lymphoma and especially in a large subset of Diffuse large B-cell lymphoma (DLBCL).
24869598 identified three distinct mutations in PLCgamma2 in two patients resistant to ibrutinib
24868545 amarogentin prevents platelet activation through the inhibition of PLC gamma2-PKC cascade and MAPK pathway
24489640 The relationship between upstream tyrosine kinase SYK and its target, PLCgamma2, is maximally predictive and sufficient to distinguish chronic lymphocytic leukemia from healthy controls.
24166973 early Ca(2+) fluxing provides feed-forward signal amplification by promoting anchoring of the PLCgamma2 C2 domain to phospho-SLP65.
24127488 down-regulation of PLCgamma2-beta-catenin pathway occurs in mice and humans and leads to myeloid-derived suppressor cells-mediated tumor expansion.
24080446 Single-nucleotide polymorphisms in PLCG2 gene is associated with breast cancer risk after menopausal hormone replacement therapy.
23555801 BANK1 and BLK have roles in B-cell signaling through phospholipase C gamma 2
23039362 Associations between treatment response and Lyn, Syk, PLCgamma2 and ERK were not found.
23000145 Overexpression of the altered p.Ser707Tyr protein and ex vivo experiments using affected individuals' leukocytes showed clearly enhanced PLCgamma2 activity.
22837484 PLCgamma2 participates in T cell receptor (TCR) signal transduction and plays a role in T cell selection in a transgenic mouse model.
22236196 Genomic deletions in PLCG2 cause gain of PLCgamma(2) function, leading to signaling abnormalities in multiple leukocyte subsets and a phenotype encompassing both excessive and deficient immune function.
21875593 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
21762810 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
21506110 Data indicate a role for PLCgamma2 and Ca(2+) signaling through the modulation of MEK/ERK in IL3/GM-csf stimulated human hematopoietic stem/progenitor cells.
21245382 Rac2 binding in the absence of lipid surfaces was not able to activate phospholipase C gamma 2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20336759 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
20086178 Data show that bile acid reflux present in patients with BE may increase reactive oxygen species production and cell proliferation via activation of PI-PLCgamma2, ERK2 MAP kinase, and NADPH oxidase NOX5-S, thereby contributing to the development of EA.
20068106 SYK, together with phospholipase Cgamma2, may serve as potential biomarkers to predict dasatinib therapeutic response in patients.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20041213 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
19965664 Data show that RTX treatment results in a time-dependent inhibition of the BCR-signaling cascade involving Lyn, Syk, PLC gamma 2, Akt, and ERK, and calcium mobilization.
19308021 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18728011 rac regulates its effector phospholipase Cgamma2 through interaction with a split pleckstrin homology domain
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18022864 Plasmacytoid dendritic cells express a signalosome consisting of Lyn, Syk, Btk, Slp65 (Blnk) and PLCgamma2. Triggering CD303 leads to tyrosine phosphorylation of Syk, Slp65, PLCgamma2 & cytoskeletal proteins.
18000612 intracellular mediators and pathways activated by leptin downstream of JAK2 were found to include phosphatidylinositol-3 kinase, phospholipase Cgamma2 and protein kinase C, as well as the p38 MAP kinase-phospholipase A(2) axis.
17023658 observations suggest a model in which TFII-I suppresses agonist-induced calcium entry by competing with TRPC3 for binding to phospholipase C-gamma
16172125 novel mechanism of PLCgamma(2) activation by Rac GTPases involving neither protein tyrosine phosphorylation nor PI3K-mediated generation of PtdInsP(3)
15972651 PLC-gamma1 and PLC-gamma2 both regulate the functions of ITAM-containing receptors, whereas only PLC-gamma2 regulates the function of DAP10-coupled receptors.
15744341 The PLCgamma2 is present in the majority of mediastinal B cell lymphomas.
15509800 PLC-gamma2 is phosphorylated on Y753, Y759, and Y1217 in response to engagement of the B-cell receptor
14606067 in gastric cancer, protein translocation of PLCgamma2 and PKCalpha is critical event in the process of apoptosis induction.
12813055 PLCG2 has a signaling role in platelet glycoprotein Ib alpha calcium flux and cytoskeletal reorganization
12482669 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
12359094 full-length cDNA for human PLCgamma2 and expressed it in E. coli using the expression vector pT5T
12181444 Two tyrosine residues in regulating the activity of PLCgamma2
12049640 collagen receptor glycoprotein VI and alphaIIbbeta3 trigger distinct patterns of receptor signalling in platelets, leading to tyrosine phosphorylation of PLCgamma2 (integrin alphaiibbeta3)
10843712 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
10501179 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
9730685 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
9278385 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
7589147 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics
1979339 SPRY2 interactions with PI(4,5)P2 and PLCgamma allow it to influence HIV-1 Gag release through interference with PI(4,5)P2 dynamics

AA Sequence

MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEI      1 - 70
KEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPT     71 - 140
IIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLM    141 - 210
FEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRET    211 - 280
AEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLR    281 - 350
MGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA    351 - 420
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQK    421 - 490
WTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEYCMETGGKDGT    491 - 560
FLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHYRETHLRCAEFELR    561 - 630
LTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGR    631 - 700
HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMP    701 - 770
QRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII    771 - 840
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKI    841 - 910
DTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQK    911 - 980
GLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDP    981 - 1050
MPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKV   1051 - 1120
TFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVL   1121 - 1190
ESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN   1191 - 1260
SKFYS                                                                    1261 - 1265
//

Text Mined References (107)

PMID Year Title
25972157 2015 Hypermorphic mutation of phospholipase C, ?2 acquired in ibrutinib-resistant CLL confers BTK independency upon B-cell receptor activation.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25349203 2015 HLA-DQA1 and PLCG2 Are Candidate Risk Loci for Childhood-Onset Steroid-Sensitive Nephrotic Syndrome.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25227611 2014 The autoinhibitory C-terminal SH2 domain of phospholipase C-?2 stabilizes B cell receptor signalosome assembly.
25012946 2015 Expression and pro-survival function of phospholipase C?2 in diffuse large B-cell lymphoma.
24869598 2014 Resistance mechanisms for the Bruton's tyrosine kinase inhibitor ibrutinib.
24868545 2014 Amarogentin, a secoiridoid glycoside, abrogates platelet activation through PLC ? 2-PKC and MAPK pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24642916 2014 Fine specificity and molecular competition in SLAM family receptor signalling.
24489640 2014 Multidimensional single-cell analysis of BCR signaling reveals proximal activation defect as a hallmark of chronic lymphocytic leukemia B cells.
24166973 2013 Cutting edge: feed-forward activation of phospholipase C?2 via C2 domain-mediated binding to SLP65.
24127488 2013 Down-regulation of PLC?2-?-catenin pathway promotes activation and expansion of myeloid-derived suppressor cells in cancer.
24080446 2013 Genetic modifiers of menopausal hormone replacement therapy and breast cancer risk: a genome-wide interaction study.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23555801 2013 BANK1 and BLK act through phospholipase C gamma 2 in B-cell signaling.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23039362 2013 Expression levels of Lyn, Syk, PLC?2 and ERK in patients with chronic lymphocytic leukemia, and higher levels of Lyn are associated with a shorter treatment-free survival.
23000145 2012 A hypermorphic missense mutation in PLCG2, encoding phospholipase C?2, causes a dominantly inherited autoinflammatory disease with immunodeficiency.
22837484 2012 Phospholipase C?2 plays a role in TCR signal transduction and T cell selection.
22236196 2012 Cold urticaria, immunodeficiency, and autoimmunity related to PLCG2 deletions.
21506110 2011 Requirement for PLC?2 in IL-3 and GM-CSF-stimulated MEK/ERK phosphorylation in murine and human hematopoietic stem/progenitor cells.
21269460 2011 Initial characterization of the human central proteome.
21245382 2011 Membrane environment exerts an important influence on rac-mediated activation of phospholipase C?2.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20086178 2010 Bile acid reflux contributes to development of esophageal adenocarcinoma via activation of phosphatidylinositol-specific phospholipase Cgamma2 and NADPH oxidase NOX5-S.
20068106 2010 Activities of SYK and PLCgamma2 predict apoptotic response of CLL cells to SRC tyrosine kinase inhibitor dasatinib.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19965664 2010 Rituximab inhibits B-cell receptor signaling.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19531496 2009 Characterization of phospholipase C gamma enzymes with gain-of-function mutations.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18784435 2008 Molecular profiling of isolated histological components of wilms tumor implicates a common role for the Wnt signaling pathway in kidney and tumor development.
18728011 2008 rac regulates its effector phospholipase Cgamma2 through interaction with a split pleckstrin homology domain.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
18022864 2007 CD303 (BDCA-2) signals in plasmacytoid dendritic cells via a BCR-like signalosome involving Syk, Slp65 and PLCgamma2.
18000612 2007 Leptin signalling and leptin-mediated activation of human platelets: importance of JAK2 and the phospholipases Cgamma2 and A2.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17053833 2006 PLCgamma2 regulates osteoclastogenesis via its interaction with ITAM proteins and GAB2.
17023658 2006 Action of TFII-I outside the nucleus as an inhibitor of agonist-induced calcium entry.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16249387 2006 LIME acts as a transmembrane adapter mediating BCR-dependent B-cell activation.
16172125 2005 Isozyme-specific stimulation of phospholipase C-gamma2 by Rac GTPases.
15972651 2005 The isoforms of phospholipase C-gamma are differentially used by distinct human NK activating receptors.
15953601 2005 Erythropoietin receptor Y479 couples to ERK1/2 activation via recruitment of phospholipase Cgamma.
15845450 2005 Autoimmunity and inflammation due to a gain-of-function mutation in phospholipase C gamma 2 that specifically increases external Ca2+ entry.
15744341 2005 Expression pattern of intracellular leukocyte-associated proteins in primary mediastinal B cell lymphoma.
15644415 2005 A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15509800 2004 Mechanism of B-cell receptor-induced phosphorylation and activation of phospholipase C-gamma2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15187135 2004 Binding of cytoplasmic proteins to the CD19 intracellular domain is high affinity, competitive, and multimeric.
15184383 2004 Tec kinases mediate sustained calcium influx via site-specific tyrosine phosphorylation of the phospholipase Cgamma Src homology 2-Src homology 3 linker.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14978237 2004 Differential role of Janus family kinases (JAKs) in interferon-gamma-induced lung epithelial ICAM-1 expression: involving protein interactions between JAKs, phospholipase Cgamma, c-Src, and STAT1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14606067 2003 Roles of PLC-gamma2 and PKCalpha in TPA-induced apoptosis of gastric cancer cells.
12813055 2003 Signaling role for phospholipase C gamma 2 in platelet glycoprotein Ib alpha calcium flux and cytoskeletal reorganization. Involvement of a pathway distinct from FcR gamma chain and Fc gamma RIIA.
12771181 2003 Cbl-b negatively regulates B cell antigen receptor signaling in mature B cells through ubiquitination of the tyrosine kinase Syk.
12514734 2003 LAB: a new membrane-associated adaptor molecule in B cell activation.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12470302 2002 Activation of the Syk tyrosine kinase is insufficient for downstream signal transduction in B lymphocytes.
12437926 2002 Phospholipase C-gamma is required for agonist-induced Ca2+ entry.
12359094 2002 Expression of enzymatically-active phospholipase Cgamma2 in E. coli.
12181444 2002 Activation of phospholipase Cgamma2 by tyrosine phosphorylation.
12135708 2002 Phosphatidylinositol 3-kinase regulates glycosylphosphatidylinositol hydrolysis through PLC-gamma(2) activation in erythropoietin-stimulated cells.
12093870 2002 Cbl-b positively regulates Btk-mediated activation of phospholipase C-gamma2 in B cells.
12049640 2002 Differential role of glycolipid-enriched membrane domains in glycoprotein VI- and integrin-mediated phospholipase Cgamma2 regulation in platelets.
11685467 2001 Variations in the human phospholipase Cgamma2 gene in patients with B-cell defects of unknown etiology.
11606584 2001 Tyrosine residues in phospholipase Cgamma 2 essential for the enzyme function in B-cell signaling.
11507676 2001 Potential role of Gab1 and phospholipase C-gamma in osmotic shock-induced glucose uptake in 3T3-L1 adipocytes.
11507089 2001 Four tyrosine residues in phospholipase C-gamma 2, identified as Btk-dependent phosphorylation sites, are required for B cell antigen receptor-coupled calcium signaling.
11390470 2001 Regulation of NK cell-mediated cytotoxicity by the adaptor protein 3BP2.
11274146 2001 The adaptor protein BLNK is required for b cell antigen receptor-induced activation of nuclear factor-kappa B and cell cycle entry and survival of B lymphocytes.
11043765 2000 Regulation of the phospholipase C-gamma2 pathway in B cells.
10933389 2000 Xid-like phenotypes: a B cell signalosome takes shape.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10770799 2000 A novel B lymphocyte-associated adaptor protein, Bam32, regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.
10706702 2000 Systematic analysis of the role of CD19 cytoplasmic tyrosines in enhancement of activation in Daudi human B cells: clustering of phospholipase C and Vav and of Grb2 and Sos with different CD19 tyrosines.
10623845 2000 Activation of human neutrophils by Mycobacterium tuberculosis H37Ra involves phospholipase C gamma 2, Shc adapter protein, and p38 mitogen-activated protein kinase.
10501179 1999 Involvement of inositol 1,4,5-trisphosphate-regulated stores of intracellular calcium in calcium dysregulation and neuron cell death caused by HIV-1 protein tat.
10469124 1999 Evidence that phospholipase C-gamma2 interacts with SLP-76, Syk, Lyn, LAT and the Fc receptor gamma-chain after stimulation of the collagen receptor glycoprotein VI in human platelets.
10467411 1999 Evidence for SH3 domain directed binding and phosphorylation of Sam68 by Src.
10025672 1999 Molecular requirements for attachment of the glycosylphosphatidylinositol anchor to the human alpha folate receptor.
9819383 1998 Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9398617 1997 Interactions of FLT-1 and KDR with phospholipase C gamma: identification of the phosphotyrosine binding sites.
9280292 1997 Glycoprotein VI is the collagen receptor in platelets which underlies tyrosine phosphorylation of the Fc receptor gamma-chain.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
8980110 1996 Cloning and functional analysis of the hematopoietic cell-specific phospholipase C(gamma)2 promoter.
8885868 1996 Protein kinase C mu (PKC mu) associates with the B cell antigen receptor complex and regulates lymphocyte signaling.
8672127 1996 Genetic mapping of the human and mouse phospholipase C genes.
8395016 1993 Mapping of sites on the Src family protein tyrosine kinases p55blk, p59fyn, and p56lyn which interact with the effector molecules phospholipase C-gamma 2, microtubule-associated protein kinase, GTPase-activating protein, and phosphatidylinositol 3-kinase.
8226808 1993 Identification of Trk binding sites for SHC and phosphatidylinositol 3'-kinase and formation of a multimeric signaling complex.
8093016 1994 Evidence for a role for tyrosine phosphorylation of phospholipase C gamma 2 in collagen-induced platelet cytosolic calcium mobilization.
7835906 1994 Mapping the gene that encodes phosphatidylinositol-specific phospholipase C-gamma 2 in the human and the mouse.
7774933 1995 Phospholipase C gamma-2 (Plcg2) and phospholipase C gamma-1 (Plcg1) map to distinct regions in the human and mouse genomes.
7682059 1993 In vitro tyrosine phosphorylation of PLC-gamma 1 and PLC-gamma 2 by src-family protein tyrosine kinases.
7589147 1995 Exogenous human immunodeficiency virus type-1 Tat protein selectively stimulates a phosphatidylinositol-specific phospholipase C nuclear pathway in the Jurkat T cell line.
2849563 1988 Complete cDNA encoding a putative phospholipase C from transformed human lymphocytes.
2841328 1988 Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.