Property Summary

NCBI Gene PubMed Count 111
PubMed Score 86.14
PubTator Score 105.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
NEPHROTIC SYNDROME, TYPE 3 1
Disease Target Count
Nephrotic syndrome 3 1

Expression

Protein-protein Interaction (3)

Gene RIF (94)

PMID Text
26773497 In conclusion, our results suggest that miR-328 suppresses the survival of EC cells by regulating PLCE1 expression, which might be a potential therapeutic method for EC.
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26320491 Genetic Variants of PLCE1 Gene are not Associated with Colorectal Cancer.
26156799 Our results suggested that STAT3 phosphorylation is involved in PLCe-mediated inflammatory cytokine release
25854357 PLCE1 gene rs2274223 polymorphism is associated with esophageal cancer
25658482 a significantly increased stomach cancer risk was associated with PLCE1 SNP rs2274223 in a Han Chinese population.
25614244 This meta-analysis demonstrated that PLCE1 rs2274223 A > G polymorphism may be associated with increased susceptibility to cancer, especially for ESCC.
25521631 a new pathway for TRPC6 activation by Phospholipase C epsilon
25520085 The meta-analysis suggested that upregulated PLCE1 is significantly associated with an increased risk of tumor progression in esophageal squamous cell carcinoma and gastric cardia adenocarcinomas.
25434319 variation in PLCE1 may be associated with GC risk in Kashmir Valley.
25422186 PLCE1 rs2274223 polymorphism is associated with esophageal cancer.
25139097 PLCE1 rs7922612CT + TT is associated with susceptibility of esophageal cancer.
25041015 PLCE1 gene silencing by RNAi resulted in decreased expression of cyclin D1.
24985593 findings demonstrate that the presence of the G allele at rs2274223 of the PLCE1 gene may contribute to susceptibility to GC, especially cardia GC.
24935391 Genetic variations in PLCE1 modulate risk of esophageal cancer in the high risk Kashmiri population.
24884822 we conclude that rs3132468-C at MICB and rs3765524-C at PLCE1 confer risk of DSS in Southeast Asians.
24874112 PLCE1 rs2274223 polymorphism may be used as a potential biomarker for digestive tract cancer susceptibility particularly for esophageal squamous cell carcinoma and gastric cardia adenocarcinomas in the Chinese population.
24867265 Dysregulated PLCE1 mRNA expression was observed for both esophageal squamous cell carcinoma and gastric cancer
24863943 Data show that phospholipase C epsilon 1 (PLCE1) and liver X receptor-beta (LXR-beta) network interactions as important contributory factors for genetic predisposition in gallbladder cancer.
24796667 PLCepsilon1 shRNA depressed the in vitro and in vivo growth of gastric cancer cells by using MTT assay and tumor xenograft experiment.
24766303 Knockdown of PLCE1 markedly increased 9.26 folds of the expression of p53 and 13.8 folds of the frequency of apoptotic CP-C cells via modulating the p53 promoter methylation
24737582 This meta-analysis provides strong statistical evidence for an elevated risk of EC associated with PLCE1 rs2274223
24595086 Meta-analysis suggested the PLCE1 rs2274223 might act as a cancer risk factor among all subjects, especially in the Chinese population and upper aerodigestive tract cancer.
24591640 A tumor suppressor role for phospholipase C epsilon in Ras-triggered cancers.
24510280 Knockdown of PLCepsilon gene potently suppressed the nuclear factor kappa (NF-kappaB) signaling pathway.
24496148 the PLCE1 rs2274223 A > G change might reduce gene expression and the variant genotype might contribute to the increased risk of colorectal cancer.
24357048 NSCLC cells express high levels of PLCE1, which suppresses the expression of p53 in NSCLC cells.
24316392 PKCalpha/beta is critical for PLCepsilon-mediated cancer cell invasion and migration
24307345 upregulation of PLCE1 is correlated with increased expression of NF-kappaB-related proteins in Kazakh patients with esophageal squamous cell carcinoma
24254309 aim of this study was to determine whether rs4072037A > G in MUC1 at 1q22 and rs2274223A > G in PLCE1 at 10q23 are associated with a risk of gastric cancer in a Korean population
24152165 The rs2274223 polymorphism in phospholipase C epsilon 1 was associated with an increased risk of esophageal squamous cell carcinoma in this Korean population
24146276 We found PLCE1, C11orf92-C11orf93, and NOC3L associated with colorectal cancer susceptibility
24127316 heterozygote of PLCE1 rs2274223 increases susceptibility to human papillomavirus infection in patients with esophageal carcinoma among the Kazakh populations.
24116107 Data indicate that PLCE1 rs2274223 A>G polymorphism was significantly associated with increased risk of digestive tract cancer (DTC), especially among Asian populations.
23981775 Only 4 PLCE1 SNPs with moderate linkage disequilibrium confer significantly increased risk of esophageal cancer to a Chinese Kazakh population.
23975622 PLCE1 rs2274223 and rs7922612 polymorphisms are associated with gallbladder cancer susceptibility.
23958207 PLCvarepsilon and the RASSF family play roles in tumour suppression. [review]
23874915 Meta-analysis results indicated that PLCE1 rs2274223 G allele significantly contributed to the risk of ESCC and GCA, especially in Chinese population.
23826241 the PLCE1 rs2274223 polymorphism was confirmed to have a statistically significant association with an increasing risk of squamous cell carcinoma and gastric cancer.
23797815 Studies suggest phospholipase C epsilon 1 gene (PLCE1) polymorphism conferred significant risk among Asian (Chinese) but not in Caucasian.
23688607 Results further confirmed that genetic variations in PLCE1 may contribute to ESCC risk associated with tobacco exposure in a central Chinese population.
23659763 PLCE1 overexpression correlates with lymph node metastasis and advanced tumor-node-metastasis stages of Kazakh esophageal squamous cell carcinoma.
23536857 the MICB rs3132468 and PLCE1 rs3740360 genotypes are associated with clinically apparent dengue in both adults and children.
23390063 A sequence variant in the phospholipase C epsilon C2 domain is associated with esophageal carcinoma and esophagitis.
23222411 It is unlikely that the PLCE1 rs2274223 and RFT2 13042395 SNPs play a role in esophageal adenocarcinoma or esophageal squamous cell carcinoma susceptibility in Dutch Caucasians.
23079034 the PLCepsilon1 rs2274223 SNP might be an effective genetic marker to assess the risk of esophageal squamous cell carcinoma in individuals with a upper gastrointestinal cancer family history from a region of high incidence in northern China
22865593 PLCE1 gene variants are associated with esophageal squamous cell carcinoma.
22805490 rs2274223 polymorphisms in PLCE1 is associated with esophageal squamous cell carcinoma.
22744421 These findings indicated that functional polymorphisms PLCE1 rs2274223 might contribute to esophageal cancer susceptibility.
22412849 genetic variations in PLCE1 may contribute to gastric adenocarcinoma risk in an eastern Chinese population.
22203178 Single Nucleotide Polymorphisms in PLCE1 resulting in reduce gene expression are associated with esophageal squamous cell carcinoma.
22001756 identify two loci associated with susceptibility to DSS in people with dengue, suggesting possible mechanisms for this severe complication of dengue
21951843 These results suggest that PLCe constitutes a signaling pathway distinct from the NF-jB pathway and that this pathway and the NF-jB pathway exert a synergistic effect on the TNFa-stimulated CCL2 expression in keratinocytes.
21909432 Significantly deregulated pathways in colorectal cancer were identified and repression of PLCD1 and PLCE1 expression, was validated.
21837401 The PLCE1 single nucleotide polymorphism rs2274223 was associated with significantly improved gastric cancer survival in a Chinese population.
21705050 The knockdown of PLCepsilon by shRNA could inhibit bladder tumor growth and might be an alternative approach for human bladder cancer therapy
21689432 None of 3 SNPs was alone significantly associated with overall risk of SCCHN, the combined effects of rs2274223G, rs3203713G & rs11599672G were associated with risk of SCCHN in a locus-dose effect manner.
21667163 Loss of PLCE1 is associated with colorectal cancer.
21365190 Case Report: Report respiratory-chain deficiency presenting as diffuse mesangial sclerosis with NPHS3 mutation.
20729853 Suscptibility loci at PLCE1 for esophageal squamous cell carcinoma.
20729853 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20729852 Shared susceptibility locus in PLCE1 at 10q23 for gastric adenocarcinoma and esophageal squamous cell carcinoma.
20729852 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20620593 Silencing of PLCE1 might downregulate the level of MMP and BCL2 gene expression, decreasing the invasive power of bladder cancer T24 cells and thus inhibiting tumor development.
20591883 Homozygous or compound heterozygous mutations were identified in 33% (8/24) of diffuse mesangial sclerosis (DMS) cases. PLCE1 mutations were found in 8% (6/78) of FSGS cases without NPHS2 mutations.
20507940 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20336759 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19260473 This study demonstrated that PLCE1 might be a new tumor suppressor gene related to sporadic colorectal cancer.
19037252 nonpenetrance may be due to compensatory mutations at a second locus and mutation within PLCE1 is not always sufficient to cause diffuse mesangial sclerosis.
18975016 PLCE1/NPHS3 mutations are not a cause of focal and segmental glomerulosclerosis in this cohort study
18975016 Observational study of gene-disease association. (HuGE Navigator)
18270750 Discuss the recent identification of autosomal recessive nephrotic syndrome type 3 (NPHS3) caused by mutations in the phospholipase PLCE1 gene has, for the first time, shown steroid responsiveness in childhood nephrotic syndrome. (Editorial)
18065803 mutations in PLCE1 may serve as a biomarker for selecting patients with IDMS who may benefit from treatment.
17942568 BRAF interacts with PLCepsilon1 in nephrotic syndrome type 3. Both proteins are coexpressed and colocalize in developing and mature glomerular podocytes.
17449496 Mutations cause early onset nephrotic syndrome. May play a critical role in glomerular development. Review.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16565089 CD44 interaction with LARG and EGFR plays a pivotal role in Rho/Ras co-activation, PLC epsilon-Ca2+ signaling, and Raf/ERK up-regulation required for CaMKII-mediated cytoskeleton function and in head and neck squamous cell carcinoma progression
16537651 R-Ras regulates organization of actin and drives membrane protrusions through the activitiy of PLCE.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15558028 diversity introduced by splice variants could play an important role in PLCepsilon regulation
15157671 Gi-coupled receptors can inhibit PLC-epsilon.
12482669 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
12444546 phospholipase C signal is suggested to be critical for survival and growth of cells
11877431 Stimulation of phospholipase C-epsilon by the M3 muscarinic acetylcholine receptor mediated by cyclic AMP and the GTPase Rap2B
10843712 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
10501179 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
9730685 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
9278385 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
7589147 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
1979339 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat

AA Sequence

MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISQLNKLKEEPSGSNLP      1 - 70
KILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQRQFYEMYNSVAEEDLCLETGI     71 - 140
PSPLERKVFPGIQLELDRPSMGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLIL    141 - 210
DDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGD    211 - 280
SFCRKDFTDSQAAKTFLSHFEDFPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRT    281 - 350
LPSGHIGLTAWSYIDQKRNGPLLPCGRVMEPPSTVEIRQDGSQRLSEAQWYPIYNAVRREETENTVGSLL    351 - 420
HFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSGLLSTFGGS    421 - 490
TGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQTIYRRVLPVDYLCFLT    491 - 560
RDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVH    561 - 630
VAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGC    631 - 700
KVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSI    701 - 770
FQVIRSCNRSLETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFD    771 - 840
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPASSKAKLGV    841 - 910
LNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKLGSMFLSETGVTLLYGLQT    911 - 980
TDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFG    981 - 1050
GRRWSARNPSPGTSAKNAEKPNMQRNNTLGISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSG   1051 - 1120
SDPQDINEQEESEVNAIANPPNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSS   1121 - 1190
SWHGRIKGGMKGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTI   1191 - 1260
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLN   1261 - 1330
DFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFASKNDESQENIKELQLPLSY   1331 - 1400
YYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAID   1401 - 1470
RSAFINSDLPIIISIENHCSLPQQRKMAEIFKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNK   1471 - 1540
KLKAHQTPVDILKQKAHQLASMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKS   1541 - 1610
CNDKLQFEYNEEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGL   1611 - 1680
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPTTSLSAIIR   1681 - 1750
TPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDD   1751 - 1820
LPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDSMDPAVYSLTIVSGQNVCPSNSMGSP   1821 - 1890
CIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALK   1891 - 1960
RGYRHLQLRNLHNEVLEISSLFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVF   1961 - 2030
TINGGTKAKQLLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPE   2031 - 2100
EGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLC   2101 - 2170
KAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQ   2171 - 2240
ASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSESIQTKEEKPVGGLSSSDTMDYRQ           2241 - 2302
//

Text Mined References (112)

PMID Year Title
26773497 2016 MiR-328 suppresses the survival of esophageal cancer cells by targeting PLCE1.
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26320491 2015 Common Genetic Variants of PSCA, MUC1 and PLCE1 Genes are not Associated with Colorectal Cancer.
26156799 2015 Knockdown of PLC? inhibits inflammatory cytokine release via STAT3 phosphorylation in human bladder cancer cells.
25854357 2015 PLCE1 gene in esophageal cancer and interaction with environmental factors.
25658482 2015 Associations of genetic variants in the PSCA, MUC1 and PLCE1 genes with stomach cancer susceptibility in a Chinese population.
25614244 2015 Association between PLCE1 rs2274223 A > G polymorphism and cancer risk: proof from a meta-analysis.
25521631 2015 Phospholipase C epsilon (PLC?) induced TRPC6 activation: a common but redundant mechanism in primary podocytes.
25520085 2014 Prognostic value of PLCE1 expression in upper gastrointestinal cancer: a systematic review and meta-analysis.
25434319 Phospholipase C epsilon 1 (PLCE1) haplotypes are associated with increased risk of gastric cancer in Kashmir Valley.
25422186 2014 PLCE1 rs2274223 polymorphism and susceptibility to esophageal cancer: a meta-analysis.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25139097 2014 Role of novel and GWAS originated PLCE1 genetic variants in susceptibility and prognosis of esophageal cancer patients in northern Indian population.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
25041015 2014 Effects of PLCE1 gene silencing by RNA interference on cell cycling and apoptosis in esophageal carcinoma cells.
24985593 2014 Genetic polymorphism of the phospholipase C epsilon 1 gene and risk of gastric cancer.
24935391 2014 Phospholipase C epsilon 1 (PLCE1 rs2274223A>G, rs3765524C>T and rs7922612C>T) polymorphisms and esophageal cancer risk in the Kashmir Valley.
24884822 2014 A replication study confirms the association of GWAS-identified SNPs at MICB and PLCE1 in Thai patients with dengue shock syndrome.
24874112 2014 Novel functional variants locus in PLCE1 and susceptibility to digestive tract cancer in the Chinese population: a meta-analysis.
24867265 2014 PLCE1 mRNA and protein expression and survival of patients with esophageal squamous cell carcinoma and gastric adenocarcinoma.
24863943 2014 A multigenic approach to evaluate genetic variants of PLCE1, LXRs, MMPs, TIMP, and CYP genes in gallbladder cancer predisposition.
24796667 2014 PLC?1: a potential target of RNA interference therapy for gastric cancer.
24766303 2014 PLCE1 suppresses p53 expression in esophageal cancer cells.
24737582 2014 PLCE1 rs2274223 polymorphism contributes to risk of esophageal cancer: evidence based on a meta-analysis.
24595086 2013 Meta-analysis of phospholipase C epsilon 1 polymorphism and cancer risk.
24591640 2014 Tumor suppressor role of phospholipase C epsilon in Ras-triggered cancers.
24510280 2014 Nuclear factor-?B signaling pathway is involved in phospholipase C?-regulated proliferation in human renal cell carcinoma cells.
24496148 2014 Association between phospholipase C epsilon gene (PLCE1) polymorphism and colorectal cancer risk in a Chinese population.
24357048 2014 Phospholipase C ?-1 inhibits p53 expression in lung cancer.
24316392 2014 A new PKC?/?/TBX3/E-cadherin pathway is involved in PLC?-regulated invasion and migration in human bladder cancer cells.
24307345 2014 Elevated expression patterns and tight correlation of the PLCE1 and NF-?B signaling in Kazakh patients with esophageal carcinoma.
24254309 2014 Common genetic variants at 1q22 and 10q23 and gastric cancer susceptibility in a Korean population.
24152165 Replication of results of genome-wide association studies on esophageal squamous cell carcinoma susceptibility loci in a Korean population.
24146276 2014 Genetic association of PLCE1, C11orf92-C11orf93, and NOC3L with colorectal cancer risk in the Han population.
24127316 2014 Heterozygote of PLCE1 rs2274223 increases susceptibility to human papillomavirus infection in patients with esophageal carcinoma among the Kazakh populations.
24116107 2013 Increased risk of developing digestive tract cancer in subjects carrying the PLCE1 rs2274223 A>G polymorphism: evidence from a meta-analysis.
23981775 2013 Multiple polymorphisms within the PLCE1 are associated with esophageal cancer via promoting the gene expression in a Chinese Kazakh population.
23975622 2013 Association of potentially functional genetic variants of PLCE1 with gallbladder cancer susceptibility in north Indian population.
23958207 2013 PLC? and the RASSF family in tumour suppression and other functions.
23874915 2013 Esophageal squamous cell carcinoma and gastric cardia adenocarcinoma shared susceptibility locus in PLCE1: a meta-analysis.
23826241 2013 PLCE1 polymorphism and upper gastrointestinal cancer risk: a meta-analysis.
23797815 2013 PLCE1 rs2274223 A>G polymorphism and cancer risk: a meta-analysis.
23688607 2013 Novel functional variants locus in PLCE1 and susceptibility to esophageal squamous cell carcinoma: based on published genome-wide association studies in a central Chinese population.
23659763 2013 Overexpression of PLCE1 in Kazakh esophageal squamous cell carcinoma: implications in cancer metastasis and aggressiveness.
23536857 2013 Genetic variants of MICB and PLCE1 and associations with non-severe dengue.
23390063 2013 A sequence variant in the phospholipase C epsilon C2 domain is associated with esophageal carcinoma and esophagitis.
23222411 2013 GWAS-uncovered SNPs in PLCE1 and RFT2 genes are not implicated in Dutch esophageal adenocarcinoma and squamous cell carcinoma etiology.
23079034 2012 PLC-?1 gene polymorphisms significantly enhance the risk of esophageal squamous cell carcinoma in individuals with a family history of upper gastrointestinal cancers.
22865593 2012 Distinct genetic association at the PLCE1 locus with oesophageal squamous cell carcinoma in the South African population.
22805490 2012 Genetic variation in C20orf54, PLCE1 and MUC1 and the risk of upper gastrointestinal cancers in Caucasian populations.
22744421 2012 Replication study of PLCE1 and C20orf54 polymorphism and risk of esophageal cancer in a Chinese population.
22412849 2012 Potentially functional variants of PLCE1 identified by GWASs contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.
22203178 2012 Putatively functional PLCE1 variants and susceptibility to esophageal squamous cell carcinoma (ESCC): a case-control study in eastern Chinese populations.
22001756 2011 Genome-wide association study identifies susceptibility loci for dengue shock syndrome at MICB and PLCE1.
21951843 2011 PLC? cooperates with the NF-?B pathway to augment TNF?-stimulated CCL2/MCP1 expression in human keratinocyte.
21909432 2011 Phospholipase C isozymes are deregulated in colorectal cancer--insights gained from gene set enrichment analysis of the transcriptome.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21837401 2011 Genetic variation in PLCE1 is associated with gastric cancer survival in a Chinese population.
21705050 2011 shRNA targeting PLC? inhibits bladder cancer cell growth in vitro and in vivo.
21689432 2011 Association between novel PLCE1 variants identified in published esophageal cancer genome-wide association studies and risk of squamous cell carcinoma of the head and neck.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21667163 2012 Phospholipase C epsilon plays a suppressive role in incidence of colorectal cancer.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21368711 2011 Genome-wide association study of personality traits in bipolar patients.
21365190 2011 Respiratory-chain deficiency presenting as diffuse mesangial sclerosis with NPHS3 mutation.
20729853 2010 Genome-wide association study of esophageal squamous cell carcinoma in Chinese subjects identifies susceptibility loci at PLCE1 and C20orf54.
20729852 2010 A shared susceptibility locus in PLCE1 at 10q23 for gastric adenocarcinoma and esophageal squamous cell carcinoma.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20620593 2010 RNA interference suppressing PLCE1 gene expression decreases invasive power of human bladder cancer T24 cell line.
20591883 2010 Mutational analysis of the PLCE1 gene in steroid resistant nephrotic syndrome.
20507940 2010 Genotype-phenotype correlations in non-Finnish congenital nephrotic syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19260473 Screening of new tumor suppressor genes in sporadic colorectal cancer patients.
19037252 2009 Mutations in phospholipase C epsilon 1 are not sufficient to cause diffuse mesangial sclerosis.
18975016 2009 Exclusion of homozygous PLCE1 (NPHS3) mutations in 69 families with idiopathic and hereditary FSGS.
18270750 2008 NPHS3: new clues for understanding idiopathic nephrotic syndrome.
18065803 2008 Mutations in PLCE1 are a major cause of isolated diffuse mesangial sclerosis (IDMS).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17942568 2008 Identification of BRAF as a new interactor of PLCepsilon1, the protein mutated in nephrotic syndrome type 3.
17449496 2007 Familial nephrotic syndrome: PLCE1 enters the fray.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17086182 2006 Positional cloning uncovers mutations in PLCE1 responsible for a nephrotic syndrome variant that may be reversible.
16565089 2006 Hyaluronan-CD44 interaction with leukemia-associated RhoGEF and epidermal growth factor receptor promotes Rho/Ras co-activation, phospholipase C epsilon-Ca2+ signaling, and cytoskeleton modification in head and neck squamous cell carcinoma cells.
16537651 2006 The small GTPase R-Ras regulates organization of actin and drives membrane protrusions through the activity of PLCepsilon.
16483931 2006 Structural and mechanistic insights into ras association domains of phospholipase C epsilon.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16293787 2005 Phospholipase C epsilon modulates beta-adrenergic receptor-dependent cardiac contraction and inhibits cardiac hypertrophy.
15558028 2005 Signaling properties and expression in normal and tumor tissues of two phospholipase C epsilon splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15157671 2004 Inhibition of phospholipase C-epsilon by Gi-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878163 2003 Identification of Tyr900 in the kinase domain of c-Kit as a Src-dependent phosphorylation site mediating interaction with c-Crk.
12721365 2003 Activation of CD4 T cells by Raf-independent effectors of Ras.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444546 2002 Differential roles of Ras and Rap1 in growth factor-dependent activation of phospholipase C epsilon.
11877431 2002 Stimulation of phospholipase C-epsilon by the M3 muscarinic acetylcholine receptor mediated by cyclic AMP and the GTPase Rap2B.
11715024 2001 A new phospholipase-C-calcium signalling pathway mediated by cyclic AMP and a Rap GTPase.
11395506 2001 Role of the CDC25 homology domain of phospholipase Cepsilon in amplification of Rap1-dependent signaling.
11022048 2001 Regulation of a novel human phospholipase C, PLCepsilon, through membrane targeting by Ras.
11022047 2001 A novel bifunctional phospholipase c that is regulated by Galpha 12 and stimulates the Ras/mitogen-activated protein kinase pathway.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10501179 1999 Involvement of inositol 1,4,5-trisphosphate-regulated stores of intracellular calcium in calcium dysregulation and neuron cell death caused by HIV-1 protein tat.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
7589147 1995 Exogenous human immunodeficiency virus type-1 Tat protein selectively stimulates a phosphatidylinositol-specific phospholipase C nuclear pathway in the Jurkat T cell line.