Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.80
PubTator Score 14.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.700 2.1e-02
ependymoma 2.200 2.2e-02
oligodendroglioma 1.700 3.1e-02
osteosarcoma 1.588 4.4e-06
group 3 medulloblastoma -2.200 7.1e-03
glioblastoma 1.100 9.1e-04
medulloblastoma, large-cell -1.200 4.7e-04
active Crohn's disease -1.681 1.4e-02
interstitial cystitis -1.500 1.4e-03
pediatric high grade glioma 1.100 2.1e-02
atypical teratoid/rhabdoid tumor -1.200 1.2e-05
ovarian cancer 1.300 2.3e-09

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (17)

PMID Text
23948486 PLCdelta3 regulates microvilli formation in enterocytes and the radial migration of neurons in the cerebral cortex of the developing brain. [review]
22723964 In mouse, Plcd1 and Plcd3 may act together in murine hair follicles.
21951552 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19344632 Data are consistent with the idea that phospholipase C d1 and d3 isoforms support the growth and migration of normal and neoplastic mammary epithelial cells in vitro.
19329342 Observational study of gene-disease association. (HuGE Navigator)
12482669 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
10843712 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
10501179 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
9730685 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
9278385 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
7589147 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C
1979339 HIV-1 Tat induces release of calcium and TNF-alpha production, an effect mediated at least in part by activation of phospholipase C

AA Sequence

MLCGRWRRCRRPPEEPPVAAQVAAQVAAPVALPSPPTPSDGGTKRPGLRALKKMGLTEDEDVRAMLRGSR      1 - 70
LRKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRRFGGAFAPARCLT     71 - 140
IAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSL    141 - 210
LRMVNVDMNDMYAYLLFKECDHSNNDRLEGAEIEEFLRRLLKRPELEEIFHQYSGEDRVLSAPELLEFLE    211 - 280
DQGEEGATLARAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALDNTHTCVFQDMNQPLAHYFISS    281 - 350
SHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVRDHAFT    351 - 420
LSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSPNPEELPSPEQLKGRVLVKGKKLPAARSE    421 - 490
DGRALSDREEEEEDDEEEEEEVEAAAQRRLAKQISPELSALAVYCHATRLRTLHPAPNAPQPCQVSSLSE    491 - 560
RKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLV    561 - 630
NGQCGYVLKPACLRQPDSTFDPEYPGPPRTTLSIQVLTAQQLPKLNAEKPHSIVDPLVRIEIHGVPADCA    631 - 700
RQETDYVLNNGFNPRWGQTLQFQLRAPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSK    701 - 770
DGASLSPATLFIQIRIQRS                                                       771 - 789
//

Text Mined References (30)

PMID Year Title
23948486 2013 Physiological functions of phospholipase C?1 and phospholipase C?3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22723964 2012 Alopecia in a viable phospholipase C delta 1 and phospholipase C delta 3 double mutant.
21472267 Gene expression analysis reveals novel altered genes in nasal polyps.
21035487 2011 Phospholipase C?3 is a novel binding partner of myosin VI and functions as anchoring of myosin VI on plasma membrane.
20852445 2011 Common variants in or near FGF5, CYP17A1 and MTHFR genes are associated with blood pressure and hypertension in Chinese Hans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19344632 2009 Expression and function of phospholipase C in breast carcinoma.
19329342 2009 Phosphoinositide cycle gene polymorphisms affect the plasma lipid profile in the Quebec Family Study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17041247 2006 Phospholipase C isoforms are localized at the cleavage furrow during cytokinesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15505048 2004 Expression of phospholipases A2 and C in human corneal epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11706040 2002 Membrane targeting of C2 domains of phospholipase C-delta isoforms.
11500033 2001 Downregulation of phospholipase C delta3 by cAMP and calcium.
10702670 1999 Assignment of the human PLC delta3 gene (PLCD3) to human chromosome band 17q21 by fluorescence in situ hybridization.
10336610 1999 Phospholipase C-delta3 binds with high specificity to phosphatidylinositol 4,5-bisphosphate and phosphatidic acid in bilayer membranes.
9799116 1998 Localization of phospholipase C delta3 in the cell and regulation of its activity by phospholipids and calcium.
9360711 1997 Expression, purification and kinetic properties of human recombinant phospholipase C delta 3.
9056492 1997 Phospholipase C isoforms delta 1 and delta 3 from human fibroblasts. High-yield expression in Escherichia coli, simple purification, and properties.