Property Summary

NCBI Gene PubMed Count 58
PubMed Score 137.54
PubTator Score 116.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.000 3.1e-06
psoriasis 2.200 4.9e-05
posterior fossa group A ependymoma 1.300 7.7e-09
glioblastoma 1.300 2.9e-03
lung cancer -1.300 9.0e-03
interstitial cystitis -1.200 3.0e-04
group 3 medulloblastoma -1.600 1.1e-03
ulcerative colitis -1.600 5.6e-08

Gene RIF (47)

PMID Text
26755577 slow phase of Gi/o-mediated TRPC4 activation was diminished by inhibiting RhoA or enhancing PLCdelta function
25995263 Both unsaturated and saturated dioleoyl-phosphatidylinositol-(4,5)-bisphosphate successfully recruited PHPLCdelta1 to cell membranes.
25655282 Ectopic expression of PLCD1 inhibits breast tumor cell proliferation in vivo by inducing apoptosis and suppressed tumor cell migration by regulating cytoskeletal reorganization.
25477137 PLC-delta1 and TRPV6 are critical actor of Ca(2+) homeostasis in CF human bronchial epithelial cells.
25130443 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
24903829 Neuropeptide Y decreased PLCD1 expression in HUVECs.
23948486 PLCdelta1 is required for maintenance of homeostasis in skin and metabolic tissues. [review]
23388389 Provide evidence for intramolecular interactions in the PLC-delta1 PH domain.
23149345 Genotyping using microsatellite markers linked the families to the gene PLCD1 on chromosome 3p22.2. Sequence analysis of the gene detected one novel (p.Ser740ArgfsX19) and one previously reported mutation (p.Arg437X).
22576628 PLCD1 acts as a functional tumor suppressor and may serve as a biomarker for possible early detection and prognosis of chronic myeloid leukemia.
22458588 A novel mutation in the PLCD1 gene, which leads to an aberrant splicing event, underlies autosomal recessive leuconychia.
22265909 Increased PLC-delta1 activity causes enhanced coronary vasomotility such as that seen in patients with coronary spastic angina.
22078044 Mutations in this gene cause hereditary porcelain nails. Review.
21951552 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
21909432 Significantly deregulated pathways in colorectal cancer were identified and repression of PLCD1 and PLCE1 expression, was validated.
21665001 these data show that mutations in PLCD1 underlie hereditary leukonychia, revealing a gene involved in molecular control of nail growth.
20657189 PLCD1 is silenced by promoter methylation in breast cancer. Silencing of PLCD1 is reversed by demethylation which leads to the disruption of cell cycle at G2/M phase in breast cancer, indicating that PLCD1 functions as a tumor suppressor in this tumor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530480 Rac1 activates phospholipase Cdelta1 through phospholipase Cbeta2
20398908 Observational study of gene-disease association. (HuGE Navigator)
20336759 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20018811 After PLC-delta 1 treatment with small interfering RNA, angiotensin II type 1 receptor-stimulated inositol phosphate formation is attenuated.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19448674 PLCD1 acts as a functional tumor suppressor involved in gastric carcinogenesis.
19344632 Data are consistent with the idea that phospholipase C d1 and d3 isoforms support the growth and migration of normal and neoplastic mammary epithelial cells in vitro.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19008404 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
18434237 Human ARHGAP6 protein possessing GTPase stimulating activity for RhoA on the catalytic properties of PLC-delta1, was studied.
18006814 PLC delta 1 plays an important suppressive role in the development and progression of esophageal squamous cell carcinoma
17041247 These results support the model that activation of selected PLC isoforms at the cleavage furrow controls progression of cytokinesis through regulation of PIP2 levels
16240320 In this review, recent findings regarding the molecular machineries and mechanisms of the nucleocytoplasmic shuttling of PLCdelta1 will be discussed.
15817490 the Ral-CaM complex defines a multifaceted regulatory mechanism for PLC-delta1 activation
15809301 Nuclear translocation of phospholipase C-delta1 is linked to the cell cycle and nuclear phosphatidylinositol 4,5-bisphosphate
15509571 results support a model in which PLCbeta2 suppresses the basal catalytic activity of PLCdelta1, which is relieved by binding of Gbetagamma subunits to PLCbeta2 allowing for amplified calcium signals
15037625 PLCdelta(1) and PLCdelta(4) are probably differentially regulated in distinct cellular compartments by PI(4,5)P(2)
14550290 the PLC-delta1 promoter is under the control of NF-kappaB, which mediates the expression of PLC-delta due to Abeta42
12761218 Pleckstrin homology domains of phospholipases C-beta and -delta confer activation through a common site
12482669 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
11960991 Mechanism of 17-beta-estradiol-induced Erk1/2 activation in breast cancer cells. A role for HER2 AND PKC-delta
10843712 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
10501179 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
9730685 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
9278385 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
7589147 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
1979339 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips

AA Sequence

MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIE      1 - 70
DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQK     71 - 140
LQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQ    141 - 210
RVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLL    211 - 280
SADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQ    281 - 350
EPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG    351 - 420
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQ    421 - 490
ELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSS    491 - 560
NYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKR    561 - 630
LNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALI    631 - 700
RFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD                  701 - 756
//

Text Mined References (62)

PMID Year Title
26755577 2016 Critical roles of Gi/o proteins and phospholipase C-?1 in the activation of receptor-operated TRPC4 channels.
25995263 2015 Phosphatidylinositol-(4,5)-Bisphosphate Acyl Chains Differentiate Membrane Binding of HIV-1 Gag from That of the Phospholipase C?1 Pleckstrin Homology Domain.
25655282 2015 Methylation of PLCD1 and adenovirus-mediated PLCD1 overexpression elicits a gene therapy effect on human breast cancer.
25477137 2015 The low PLC-?1 expression in cystic fibrosis bronchial epithelial cells induces upregulation of TRPV6 channel activity.
24903829 2014 Neuropeptide Y reduces the expression of PLCB2, PLCD1 and selected PLC genes in cultured human endothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948486 2013 Physiological functions of phospholipase C?1 and phospholipase C?3.
23388389 2013 Intramolecular allosteric interaction in the phospholipase C-?1 pleckstrin homology domain.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149345 Mutations in the gene phospholipase C, delta-1 (PLCD1) underlying hereditary leukonychia.
22576628 2012 Epigenetic inactivation of PLCD1 in chronic myeloid leukemia.
22458588 2012 A novel mutation in the PLCD1 gene, which leads to an aberrant splicing event, underlies autosomal recessive leuconychia.
22265909 2012 Coronary vasospasm induced in transgenic mouse with increased phospholipase C-?1 activity.
22078044 2011 [Of genes and nails].
21909432 2011 Phospholipase C isozymes are deregulated in colorectal cancer--insights gained from gene set enrichment analysis of the transcriptome.
21665001 2011 Hereditary leukonychia, or porcelain nails, resulting from mutations in PLCD1.
20657189 2010 PLCD1 is a functional tumor suppressor inducing G(2)/M arrest and frequently methylated in breast cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20530480 2010 The small G protein Rac1 activates phospholipase Cdelta1 through phospholipase Cbeta2.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20018811 2010 The small GTPase Ral couples the angiotensin II type 1 receptor to the activation of phospholipase C-delta 1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19448674 2009 Phospholipase C delta 1 is a novel 3p22.3 tumor suppressor involved in cytoskeleton organization, with its epigenetic silencing correlated with high-stage gastric cancer.
19344632 2009 Expression and function of phospholipase C in breast carcinoma.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18434237 2008 Regulation of phospholipase C-delta1 by ARGHAP6, a GTPase-activating protein for RhoA: possible role for enhanced activity of phospholipase C in hypertension.
18006814 2007 Characterization of a novel tumor-suppressor gene PLC delta 1 at 3p22 in esophageal squamous cell carcinoma.
17041247 2006 Phospholipase C isoforms are localized at the cleavage furrow during cytokinesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16240320 2006 Nucleocytoplasmic shuttling of phospholipase C-delta1: a link to Ca2+.
16115628 2005 Phospholipase Cdelta1 associates with importin beta1 and translocates into the nucleus in a Ca2+-dependent manner.
15817490 2005 Regulation of phospholipase C-delta1 through direct interactions with the small GTPase Ral and calmodulin.
15809301 2005 Nuclear translocation of phospholipase C-delta1 is linked to the cell cycle and nuclear phosphatidylinositol 4,5-bisphosphate.
15702972 2005 Molecular cloning and characterization of a novel phospholipase C, PLC-eta.
15509571 2005 Phospholipase Cbeta2 binds to and inhibits phospholipase Cdelta1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15037625 2004 The pleckstrin homology domain of phosphoinositide-specific phospholipase Cdelta4 is not a critical determinant of the membrane localization of the enzyme.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14550290 2003 Amyloid beta peptide (Abeta42) activates PLC-delta1 promoter through the NF-kappaB binding site.
12761218 2003 The Pleckstrin homology domains of phospholipases C-beta and -delta confer activation through a common site.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11960991 2002 Mechanism of 17-beta-estradiol-induced Erk1/2 activation in breast cancer cells. A role for HER2 AND PKC-delta.
11706040 2002 Membrane targeting of C2 domains of phospholipase C-delta isoforms.
11336645 2001 Single-cell imaging of graded Ins(1,4,5)P3 production following G-protein-coupled-receptor activation.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10501179 1999 Involvement of inositol 1,4,5-trisphosphate-regulated stores of intracellular calcium in calcium dysregulation and neuron cell death caused by HIV-1 protein tat.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9588182 1998 Mutation in the pleckstrin homology domain of the human phospholipase C-delta 1 gene is associated with loss of function.
9512491 1998 Phospholipase C-delta1 and oxytocin receptor signalling: evidence of its role as an effector.
9345909 1997 Genomic structure of the human PLCD1 (phospholipase C delta 1) locus on 3p22-->p21.3.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9056492 1997 Phospholipase C isoforms delta 1 and delta 3 from human fibroblasts. High-yield expression in Escherichia coli, simple purification, and properties.
8672127 1996 Genetic mapping of the human and mouse phospholipase C genes.
8381210 1993 Inositol trisphosphate and calcium signalling.
7890667 1995 Cloning and identification of amino acid residues of human phospholipase C delta 1 essential for catalysis.
7589147 1995 Exogenous human immunodeficiency virus type-1 Tat protein selectively stimulates a phosphatidylinositol-specific phospholipase C nuclear pathway in the Jurkat T cell line.