Property Summary

NCBI Gene PubMed Count 42
PubMed Score 57.69
PubTator Score 29.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Uveal melanoma 20 3.955 2.0
Auriculo-condylar syndrome 3 0.0 0.0
Melanoma 711 0.0 0.0

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.400 9.4e-04
Astrocytoma, Pilocytic -2.800 1.4e-07
atypical teratoid / rhabdoid tumor -2.700 5.4e-05
Breast cancer 1.900 3.3e-02
cutaneous lupus erythematosus -1.300 3.1e-03
cystic fibrosis and chronic rhinosinusit... -1.172 4.6e-02
ependymoma -1.500 8.9e-06
glioblastoma -2.000 1.9e-05
group 4 medulloblastoma -1.700 9.6e-03
interstitial cystitis -1.200 7.1e-03
intraductal papillary-mucinous adenoma (... 2.300 7.3e-03
intraductal papillary-mucinous carcinoma... 3.300 4.7e-04
intraductal papillary-mucinous neoplasm ... 2.600 1.1e-02
invasive ductal carcinoma -1.031 4.7e-03
lung adenocarcinoma -1.500 1.7e-08
lung cancer 1.800 7.7e-04
lung carcinoma 1.300 1.0e-11
malignant mesothelioma -1.100 2.9e-04
non-small cell lung cancer -1.007 4.9e-05
ovarian cancer 1.100 4.4e-02
psoriasis -2.400 3.3e-10

Gene RIF (31)

AA Sequence

MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRS      1 - 70
GAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANN     71 - 140
VSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPTAFSYEKFY    141 - 210
ELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDED    211 - 280
LKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVL    281 - 350
LAGCRCVELDCWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM    351 - 420
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPA    421 - 490
NILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLVTVEDEQAWMASYKYVGATTN    491 - 560
IHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVD    561 - 630
SSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIA    631 - 700
ATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVL    701 - 770
RIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK    771 - 840
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKG    841 - 910
IELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILE    911 - 980
KAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELL    981 - 1050
KKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLE   1051 - 1120
ERKRLAMKQSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV                  1121 - 1175
//

Text Mined References (44)

PMID Year Title