Property Summary

NCBI Gene PubMed Count 52
PubMed Score 63.73
PubTator Score 68.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.081 1.1e-02

Protein-protein Interaction (164)

GNAT3   CCL21   CXCL11   PIP5K1B   CCL25   CCL16   SYNJ1   CXCL13   PIP5K1C   RAMP1   RAMP2   RAMP3   S1PR2   RASGRP1   UTS2   S1PR4   F2   TSHB   CALCA   PTH   VIP   GHRH   PPBP   PF4   CXCL10   RLN2   APP   CALCA   SCT   NPS   SAA1   ADORA3   PYY   CXCL8   PTHLH   CCL5   TSHR   ADRA2C   TAC1   TRH   TBXA2R   ACKR3   HTR2C   AVPR2   SSTR1   SSTR2   SSTR4   VIPR1   CXCR5   SSTR3   TRHR   SSTR5   AVPR1A   VIPR2   CCR2   CXCL5   GLP1R   SCTR   AVPR1B   XCL1   CXCL12   PTH2R   CXCR3   CCR9   CCL23   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   PTEN   CXCR4   SST   PIP4K2B   CCL20   CXCL6   QRFP   OCRL   PTH1R   CXCL9   TRPC3   PNOC   GPR176   ITPR2   ITPR1   INPP5J   NMS   DGKK   GPRC6A   NPSR1   UTS2B   RASGRP2   TAS2R42   ADM2   DGKH   GPHB5   MT-RNR2   GPR65   NPW   DAGLB   PROKR2   NPB   GPR150   PIP4K2C   PROKR1   HCAR2   OXER1   GPBAR1   RXFP4   RLN3   KISS1R   MCHR2   PTH2   ITPKC   QRFPR   OXGR1   TAAR1   GPHA2   CCL19   PIP5K1A   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   CXCL16   NMUR1   PROK2   TRPC7   GPR84   CCL28   HEBP1   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   XCL2   GHRL   TAC3   UTS2R   GPR132   TRPC6   GPR55   DAGLA   CCL27  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
720704 screening 662 / 0 / 369614 Fluorescence-based biochemical high throughput primary assay to identify inhibitors of phospholipase C isozymes (PLC-beta3).
720731 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of phospholipase C isozymes (PLC-beta 3).
743261 screening 36 / 0 / 3228 Fluorescence-based biochemical high throughput confirmation assay to identify inhibitors of phospholipase C isozymes (PLC-B3)
743328 confirmatory 0 / 0 / 157 Fluorescence-based biochemical high throughput dose response assay to identify inhibitors of phospholipase C isozymes (PLC-B3)

Gene RIF (33)

PMID Text
26490115 the MCP1-induced cortactin phosphorylation is dependent on PLCb3-mediated PKC activation, and siRNA-mediated down-regulation of either of these molecules prevents cortactin interaction with WAVE2
26468229 Gnb isoforms control a signaling pathway comprising Rac1, Plcbeta2, and Plcbeta3 leading to LFA-1 activation and neutrophil arrest in vivo
25193662 membranes are integral for the activation of PLC-beta isozymes by diverse modulators.
24642259 This study provides an understanding of the structural basis for the PDZ-mediated NHERF1-PLCbeta3 interaction that could prove valuable in selective drug design against CXCR2-related cancers.
24596086 the M3 muscarinic receptor maximizes the efficiency of PLCbeta3 signaling beyond its canonical role as a guanine nucleotide exchange factor for Galpha.
23377541 phospholipase C-beta3 structure reveals the role of the its distal C-terminal domain
23006664 PLCbeta3 is enriched in the cytosol.
22728827 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
22528496 PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-beta3 (PLC-beta3)-specific activation of somatostatin by forming a ternary complex with PLC-beta3 and somatostatin receptors.
21705626 Stromal cell-derived factor-1 signaling via the CXCR4-TCR heterodimer uses PLC-beta3 to activate the Ras-ERK pathway and increase intracellular calcium ion concentrations
21411730 Data demonstrate that PLCB3, by regulating intracellular calcium transients, plays a relevant role in amplifying the expression and release of IL-8, the major chemokine recruiting neutrophils in CF airway lungs.
21304157 Studies indicate that the complex between the effector protein phospholipase C-beta3 (PLC-beta3) and its activator, Galpha(q), suggests that several effectors independently evolved a structurally similar helix-turn-helix segment for G protein recognition.
21266572 Activation of hPLCbeta3 by U73122 required covalent modification of cysteines as evidenced by the observation that enzyme activation was attenuated by thiol-containing nucleophiles, l-cysteine and glutathione.
20966218 study describe the structure of PLC-beta3 in an activated complex with Galphaq, which together with supporting biochemical and physiological analyses reveals its mechanism of transmembrane signaling
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20336759 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19295129 VEGF, specifically through VEGFR2, induces phosphorylation of two serine residues on PLCbeta3.
18411281 PLCbeta3 may provide a selective target for inhibiting Ca(2+) responses to mediators of inflammation, including C5a, UDP, PAF, and LPA
18322273 both negative crosstalk from the cAMP/PRKA pathway and a negative feedback loop in the oxytocin/G protein/PLCB pathway involving PRKC operate in myometrial cells
17492941 Fission of transport carriers at the trans-Golgi network is dependent on specifically PLCbeta3, which is necessary to activate PKCeta and PKD in that Golgi compartment, via diacylglycerol production.
16763092 Homodimerization of PLC-beta3 and PLC-beta1 isoenzymes was observed but heterodimerization of these isoenzymes was not detected.
15998840 reduced Ca(2+) signaling in high glucose cannot be explained by reduced Ca(2+) stores but is due to conventional PKC-dependent phosphorylation and inactivation of PLC-beta(3)
15782111 findings demonstrated that G-protein-activated phospholipase C-beta interacts with cell polarity proteins Par3 and Par6 to form protein complexes and to mediate downstream signal transduction
12821674 PLC beta 3 and PLC beta 1 bind to calmodulin
12482669 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
10843712 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
10501179 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
9730685 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
9278385 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
7589147 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat
1979339 Phospholipase C/protein kinase C pathway-dependent phosphorylation of p44/42 and JNK MAP kinases is partially involved in IL-1beta induction by HIV-1 Tat

AA Sequence

MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNMEVDTLDISSIR      1 - 70
DTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNFMAVQDDTAKVWSEELFKLAM     71 - 140
NILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFSADKKRVETALESCGLKFNRSESIRPDEFSL    141 - 210
EIFERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYE    211 - 280
PNQQFLERDQMSMEGFSRYLGGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMY    281 - 350
RQALLWGCRCVELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK    351 - 420
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDSAGRKRPLEQS    421 - 490
NSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADREDEEE    491 - 560
DEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPVKFKSFEAARKRNKCFEMSSFVETKAMEQLT    561 - 630
KSPMEFVEYNKQQLSRIYPKGTRVDSSNYMPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLL    631 - 700
KPEFMRRPDKSFDPFTEVIVDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGN    701 - 770
SFNPVWDEEPFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI    771 - 840
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQLGSQPSSNPTP    841 - 910
SPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGHKALVKLRSRQERDLRELRKK    911 - 980
HQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVEDTKEGEDEAKRYQEFQNRQVQSLLELREAQV    981 - 1050
DAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAE   1051 - 1120
LTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRS   1121 - 1190
LLGEMPEGLGDGPLVACASNGHAPGSSGHLSGADSESQEENTQL                             1191 - 1234
//

Text Mined References (63)

PMID Year Title
26490115 2015 PLC?3 mediates cortactin interaction with WAVE2 in MCP1-induced actin polymerization and cell migration.
26468229 2016 Gnb isoforms control a signaling pathway comprising Rac1, Plc?2, and Plc?3 leading to LFA-1 activation and neutrophil arrest in vivo.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25193662 2014 Membrane-induced allosteric control of phospholipase C-? isozymes.
24642259 2014 Crystallographic analysis of NHERF1-PLC?3 interaction provides structural basis for CXCR2 signaling in pancreatic cancer.
24596086 2014 M3 muscarinic receptor interaction with phospholipase C ?3 determines its signaling efficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23377541 2013 Full-length G?(q)-phospholipase C-?3 structure reveals interfaces of the C-terminal coiled-coil domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23006664 2013 PLC? isoforms differ in their subcellular location and their CT-domain dependent interaction with G?q.
22728827 2012 GPCR activation of Ras and PI3Kc in neutrophils depends on PLCb2/b3 and the RasGEF RasGRP4.
22528496 2012 PDZ domain-containing 1 (PDZK1) protein regulates phospholipase C-?3 (PLC-?3)-specific activation of somatostatin by forming a ternary complex with PLC-?3 and somatostatin receptors.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21705626 2011 Stromal cell-derived factor-1 signaling via the CXCR4-TCR heterodimer requires phospholipase C-?3 and phospholipase C-?1 for distinct cellular responses.
21411730 2011 Phospholipase C-?3 is a key modulator of IL-8 expression in cystic fibrosis bronchial epithelial cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21304157 2011 Galpha(q) and phospholipase C-beta: turn on, turn off, and do it fast.
21269460 2011 Initial characterization of the human central proteome.
21266572 2011 Direct activation of human phospholipase C by its well known inhibitor u73122.
20966218 2010 Kinetic scaffolding mediated by a phospholipase C-beta and Gq signaling complex.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19295129 2009 Distinct role of PLCbeta3 in VEGF-mediated directional migration and vascular sprouting.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18411281 2008 Signaling and cross-talk by C5a and UDP in macrophages selectively use PLCbeta3 to regulate intracellular free calcium.
18322273 2008 Multiple signals regulate phospholipase CBeta3 in human myometrial cells.
18316326 2008 Exploration of human ORFeome: high-throughput preparation of ORF clones and efficient characterization of their protein products.
17492941 2007 Phospholipase C beta3 is a key component in the Gbetagamma/PKCeta/PKD-mediated regulation of trans-Golgi network to plasma membrane transport.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16763092 2006 Phospholipase C-beta3 and -beta1 form homodimers, but not heterodimers, through catalytic and carboxyl-terminal domains.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15998840 2005 Mesangial cell-reduced Ca2+ signaling in high glucose is due to inactivation of phospholipase C-beta3 by protein kinase C.
15782111 2005 G-protein-activated phospholipase C-beta, new partners for cell polarity proteins Par3 and Par6.
15623527 2005 Apical localization of a functional TRPC3/TRPC6-Ca2+-signaling complex in polarized epithelial cells. Role in apical Ca2+ influx.
15611108 2005 Regulatory interactions between the amino terminus of G-protein betagamma subunits and the catalytic domain of phospholipase Cbeta2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15143197 2004 NHERF2 specifically interacts with LPA2 receptor and defines the specificity and efficiency of receptor-mediated phospholipase C-beta3 activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12821674 2003 Calmodulin is a phospholipase C-beta interacting protein.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11325525 2001 KN-93 inhibition of G protein signaling is independent of the ability of Ca2+/calmodulin-dependent protein kinase II to phosphorylate phospholipase Cbeta3 on 537-Ser.
11278298 2001 Phosphorylation and regulation of G-protein-activated phospholipase C-beta 3 by cGMP-dependent protein kinases.
11178984 2001 Differentially expressed cDNAs in PLCbeta3-induced tumor suppression in a human endocrine pancreatic tumor cell line: activation of the human mismatch repair protein 3 gene.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10748023 2000 Regulation of phospholipase C-beta 3 activity by Na+/H+ exchanger regulatory factor 2.
10501179 1999 Involvement of inositol 1,4,5-trisphosphate-regulated stores of intracellular calcium in calcium dysregulation and neuron cell death caused by HIV-1 protein tat.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9714794 1998 Molecular cloning and characterization of a cDNA encoding mouse phospholipase C-beta3.
9651375 1998 GTPase activating specificity of RGS12 and binding specificity of an alternatively spliced PDZ (PSD-95/Dlg/ZO-1) domain.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
7849701 1994 The phospholipase C beta 3 gene located in the MEN1 region shows loss of expression in endocrine tumours.
7789993 1995 Localization of the human phosphatidylinositol-specific phospholipase c beta 3 gene (PLCB3) within chromosome band 11q13.
7612006 1995 Structural organization and expression of the human phosphatidylinositol-specific phospholipase C beta-3 gene.
7607669 1995 Genomic organization and complete cDNA sequence of the human phosphoinositide-specific phospholipase C beta 3 gene (PLCB3).
7589147 1995 Exogenous human immunodeficiency virus type-1 Tat protein selectively stimulates a phosphatidylinositol-specific phospholipase C nuclear pathway in the Jurkat T cell line.
2841328 1988 Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.
1333955 1992 Identification, purification and characterization of a novel phosphatidylinositol-specific phospholipase C, a third member of the beta subfamily.