Property Summary

NCBI Gene PubMed Count 102
PubMed Score 332.84
PubTator Score 381.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Osteoporosis 348 0.0 1.2
non-small cell lung carcinoma 302 0.0 0.9
Disease Target Count Z-score Confidence
Epilepsy 775 3.049 1.5
Disease Target Count
West Syndrome 28

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.200 6.8e-04
Astrocytoma, Pilocytic -1.100 5.0e-03
atypical teratoid / rhabdoid tumor -4.400 1.1e-07
Breast cancer -2.400 4.6e-06
colon cancer -1.900 8.1e-03
cystic fibrosis -2.148 1.5e-05
ependymoma -2.300 3.6e-08
glioblastoma -2.100 1.6e-05
group 3 medulloblastoma -1.300 1.7e-02
lung cancer 1.200 1.4e-02
lung carcinoma -1.100 1.0e-08
medulloblastoma, large-cell -2.900 9.6e-03
osteosarcoma 1.254 2.5e-04
ovarian cancer -2.500 5.2e-05
Pick disease -1.200 3.6e-02
primitive neuroectodermal tumor -2.800 1.7e-04
psoriasis -1.200 9.3e-07
severe Alzheimer's disease -1.256 4.8e-02
tuberculosis 2.200 3.3e-07
ulcerative colitis 1.300 2.0e-04

Gene RIF (68)

AA Sequence

MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVK      1 - 70
DARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATN     71 - 140
LLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPE    141 - 210
VYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEP    211 - 280
NNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYR    281 - 350
QVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ    351 - 420
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTY    421 - 490
SDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKK    491 - 560
RNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMD    561 - 630
LAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVD    631 - 700
MFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPG    701 - 770
YHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK    771 - 840
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTI    841 - 910
EELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEP    911 - 980
SSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQ    981 - 1050
NNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKR   1051 - 1120
QEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDP   1121 - 1190
GKVNHKTPSSEELGGDIPGKEFDTPL                                               1191 - 1216
//

Text Mined References (105)

PMID Year Title