Property Summary

NCBI Gene PubMed Count 467
PubMed Score 1004.88
PubTator Score 1013.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
gastric carcinoma 1.900 4.7e-02
hepatocellular carcinoma -1.300 2.1e-05
malignant mesothelioma -2.400 1.9e-07
oligodendroglioma -1.100 3.3e-02
Barrett's esophagus 2.100 2.5e-03
esophageal adenocarcinoma 2.300 1.8e-02
glioblastoma 2.200 1.3e-03
cystic fibrosis 1.953 9.2e-07
atypical teratoid / rhabdoid tumor 1.500 2.6e-05
tuberculosis -1.900 1.7e-03
primary pancreatic ductal adenocarcinoma 2.367 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-02
colon cancer 1.900 1.0e-02
lung cancer -3.400 2.0e-05
ulcerative colitis 1.700 2.7e-06
pancreatic cancer 1.900 3.0e-02
interstitial cystitis 2.000 2.7e-04
pediatric high grade glioma 1.600 1.7e-03
posterior fossa group A ependymoma 1.200 2.4e-06
inflammatory breast cancer 1.200 3.6e-03
lung carcinoma -1.900 1.4e-14
mucosa-associated lymphoid tissue lympho... 1.053 2.2e-02
ductal carcinoma in situ 1.300 2.7e-03
invasive ductal carcinoma 1.700 2.4e-03
acute myeloid leukemia 1.400 4.4e-02
ovarian cancer 2.900 8.7e-07

Gene RIF (429)

PMID Text
27078836 The present paper develops a mathematical model of cancer recurrence besed on UPAR serum concentration.
26846181 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 uPAR expression is higher in normal pregnant women than that in patients with threatened abortion. uPAR promotes trophoblast migration and invasion during embryo implantation as well as plays a role in trophoblast differentiation into syntrophoblasts.
26764285 results show that cleaved uPAR forms are significantly increased in patients with advanced prostate cancer.
26718775 Hypoxia enhanced the endogenous uPAR mRNA and protein expression.HIF-1 protein bound the putative HIF-1 response element on the uPAR promoter.uPAR protein expression was detected in cervical cancer but not in normal cervix or CIN.
26697731 There was no statistically significant difference in the plasma SuPAR levels of psoriasis patients compared to the control group.
26577922 uPAR-VEGFR2 interaction is crucial for VEGF signaling in endothelial cells
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 our data show that uPAR is required for efficient skin tumor formation
26504024 High cytoplasmic expression of uPAR is associated with cells of rectal cancer and metastases of perienteric lymph nodes.
26451727 Both the depressed patients and suicide attempters had increased plasma soluble form of the urokinase receptor (suPAR). The levels of suPAR discriminated better between controls and suicide attempters than did C reactive protein.
26420039 Human uPAR activation and its association with beta1-integrin are required for PDGF-AB-induced migration.
26384478 Report presence of urokinase-type plasminogen activator receptor in seminal plasma, focusing on its interesting role as reliable and sensitive marker of inflammation for the differential diagnosis of male accessory gland inflammation.
26380984 In patients with IgA nephropathy, the plasma suPAR levels were associated with age, gender, renal function, the degree of tubular atrophy/interstitial fibrosis and the percentage of crescent formation.
26317203 Results found high levels of uPA and uPAR exclusively in metastatic osteosarcoma (OS)cells and suggest that malignant conversion of OS cells to uPA/uPAR axis in an autocrine and paracrine fashion.
26162494 uPAR/suPAR is elevated in most kidney diseases.
26082201 micrornas directly target the 3'untranslated region of both uPAR- and CXCR4-mRNAs.
26050228 data on the stromal macrophages immunoreactivity of uPAR, MMP-2, and MMP-9 in a few small cell lung cancer (SCLC) and lung squamous cell carcinoma (SCC) biopsies was included. uPAR, MMP-2, and MMP-9 were confirmed in stromal cells including macrophages
25925849 In HEK 293 cells, transfected with human uPAR, uPAR overexpression down-regulates PTEN and activates the PI3K/Akt-pathway.
25837250 results suggest that suPAR may function as an important paracrine signaling factor in EGFRvIII-positive GBMs, inducing an aggressive phenotype in tumor cells that are EGFRvIII-negative
25771228 Soluble urokinase plasminogen activator receptor predicted both all-cause and cardiovascular mortality in a South African black population.
25709430 suPAR is a marker of acute inflammation and can be used as predictor of acute exacerbation in COPD.
25704300 REVIEW: effects in leukocyte recruitment, phagocytic uptake of dying cells (efferocytosis) and complement regulation suggests that the central parts of systemic lupus erythematosus pathogenesis could be regulated by soluble uPAR, and vice versa
25695339 suPAR levels at 6/36 hours after cardiac arrest were significantly higher in nonsurviving patients compared with survivors; however, the overlap in suPAR levels between the outcome groups was substantial, reducing the prognostic value.
25692297 Epithelial and stromal cell urokinase plasminogen activator receptor expression differentially correlates with survival in rectal cancer stages B and C patients
25664394 Results show that higher plasma uPAR levels were associated with shorter progression-free survival and overall survival of patients with metastatic colorectal cancer (mCRC) suggesting that uPAr is an independent prognostic biomarker for mCRC.
25661888 uPAR(+) cells injected subcutaneously into nude mice markedly increased tumor growth, induced VM formation and liver metastasis; by contrast, uPAR(-) cells did not.
25618124 In patients with gastrointestinal cancer the level of suPAR is high, with highest values in advances disease with remote metastases. Hhighest levels were found in patients with IV stage who underwent palliative therapy.
25575713 expression of uPAR is a possible prognostic marker that could be useful in identification of patients with aggressive, highly invasive urothelial neoplasia of the bladder
25574858 plasma suPAR level is an independent predictor of coronary microvascular function
25544710 Silencing of ETV4 suppresses invasion of prostate cancer cells by inhibiting the expression of uPA/uPAR as well as (MMP)-2 and MMP-9
25519042 The above preclinical findings strongly suggest that uPAR retargeted measles virotherapy is a novel and feasible systemic therapy strategy against metastatic breast cancer.
25500737 S- and u-suPAR after therapy may serve as clinical markers to judge the treatment response of untreated nephrotic syndrome and differentiate
25490122 Cigarette smoke elevates soluble plasminogen activator urokinase receptor isoforms in bronchial epithelial cells through direct (cleavage) and indirect (messenger RNA expression) means
25456503 Extracellular matrix biomarker, fibulin-1 and its association with soluble uPAR in a bi-ethnic South African population
25444509 Polymorphisms in this fibrinolytic system gene are associated with recurrent spontaneous abortion in Sinhalese women, probably through impaired implantation.
25329298 High suPAR levels are associated with an increased risk for both previous and future use of antidepressants in healthy men and women.
25319791 Soluble uPAR can serve as a biomarker for diagnosing sepsis and assessing disease severity.
25318615 Unique sites of interaction between alphavbeta6 and uPAR are most likely located in uPAR domains II and III.
25315615 The soluble UPAR level was significantly higher in children with a severe course of pneumonia.
25313007 Following GM1 exogenous addition, the GM3 compartment is depleted of uPAR which is recruited within caveolar rafts thereby triggering angiogenesis
25310970 uPAR has a role in inducing expression of TGFbeta and interleukin-4 in cancer cells to promote tumor-permissive conditioning of macrophages
25244504 uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2
25236186 found that miR-10b induced HCC cell invasion and migration by modulating the HOXD10 target gene RhoC, uPAR, MMP-2 and MMP-9 expression
25222341 Soluble urokinase plasminogen activator receptor, but not high-sensitive C-reactive-protein, might have a role in coronary artery calcifications in healthy middle-aged subjects
25215932 our results show, for the first time, that eEF-2K is involved in regulation of the invasive phenotype of PaCa cells through promoting a new signalling pathway, which is mediated by TG2/b1 integrin/Src/uPAR/MMP-2
25196912 expression and release, from osteoblasts of macrophage colony-stimulating factor (M-CSF), which is indispensable for osteoclast differentiation, was inhibited by uPAR loss.
25185729 Elevated serum suPAR levels are associated with reduced eGFR and presence of proteinuria in both primary and secondary glomerulonephritis.
25175595 Findings suggest a novel function of HSP70/MRJ/uPAR complex in cell adhesion, invasion and migration, and may provide more understanding in the mechanisms of uPAR-mediated cancer metastasis.
25174715 Synergy of uPAR mRNA and integrin alpha5beta1 interaction may result in abnormal signal transduction in liver cells and ultimately liver cell abnormal clonal hyperplasia and malignant transformation.
25168639 The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins.
25154621 Patients with schizophrenia had significantly higher soluble urokinase-type plasminogen activator receptor levels than healthy controls.
25127435 The main goal of this study was to evaluate the serum soluble urokinase-type plasminogen activator level in stable chronic obstructive pulmonary disease patients compared with a control group.
25120753 these data suggest that uPAR and CXCR4 co-expression predicts worse prognosis of small cell lung cancer patients
25113506 Inhibition of uPAR could sensitize HCT116 to TRAIL-induced apoptosis.
25014213 Increased levels of fibulin-1 were independently associated with higher levels of suPAR and NT-proBNP especially in patients with lower aortic valve stenosis
24999729 uPAR and PAI-1 are potential predictive biomarkers in early stage oral squamous cell carcinomas
24987841 In vascular smooth muscle cells (VSMC) U-PAR activates DNA single strand break repair signaling pathway.
24889870 Serum uPAR levels correlate with overall survival in colorectal adenocarcinoma.
24882949 soluble urokinase-type plasminogen activator receptor is expressed in term neonates with infection or sepsis
24877154 The mRNA expression levels of uPA, its receptor (uPAR), and its inhibitor type 1 (PAI-1) were analyzed in corresponding malignant and adjacent nonmalignant tissue specimens from 132 PCa patients by quantitative PCR.
24807674 Results suggest that Gal-3 modulates uPAR expression via the MEK/ERK pathway in hepatocellular carcinoma cells.
24763226 uPAR promotes nasopharyngeal carcinoma cell growth and metastasis in vivo.
24742002 This study demonstrates a significant independent negative association between colorectal cancer patient survival and uPAR expression in especially tumor-associated stromal cells.
24731575 There is a significant association between uPAR rs344781 gene promoter polymorphism and migraine without aura susceptibility but not with headache severity in Iranian patients.
24699410 Overexpression of uPAR and cathepsin B increases expression of cytosolic p-JNK.
24688027 uPAR mediates efferocytosis through high molecular weight kininogen interaction with phosphatidylserine on apoptotic cells
24648800 Suggest a possible protective effect of podocyte uPA/uPAR expression against interstitial fibrosis in IgA nephritis.
24644284 Data indicate that alpha5beta1 integrin is recruited to lipid rafts through interactions with urokinase-type plasminogen activator receptor (uPAR).
24604320 the expression of the urokinase receptor isoform exons uPAR (D1D2) increases from normal liver cells, liver cells to para-carcinoma cells.
24603291 Soluble urokinase plasminogen activator receptor is a sensitive and specific independent predictive biomarkers in preterm babies with bronchopulmonary dysplasia.
24575897 Intrahepatic uPAR activation and serum suPAR concentrations might serve as an interesting biomarker in acute liver failure.
24530340 uPAR(I-III) + (II-III) is of prognostic significance in inoperable cholangiocarcinomas.
24466048 UPAR expression renders cell migration totally.
24325546 MMP-9/uPAR overexpression enhanced the potential of glioma cell migration and invasion.
24253546 uPAR is associated with increased occurrence of carotid plaque and increased incidence of ischemic stroke
24249636 Genome-wide protein QTL mapping identifies human plasma kallikrein as a post-translational regulator of serum uPAR levels.
24217605 The uPA/uPAR angiogenesis regulatory system supports the endothelial cells that need to migrate, invade the extracellular matrix, survive, proliferate, and to re-establish new contacts with cells and the surrounding matrix. (Review)
24192237 The uPAR-C5aR axis, via the underlying NFkappaB transcriptional program, controls osteogenic differentiation with functional impact on vascular calcification in vivo.
24162774 HIV-1 gp120 upregulates the expression of plasminogen activator, urokinase receptor (PLAUR) in human B cells
23939376 RERF(urokinase receptor-derived peptide ) is a promising therapeutic agent for the control of diseases fuelled by excessive angiogenesis such as cancer.
23923008 HIV-1 infected lymphoid organs upregulate expression and release of the cleaved form of uPAR that modulates chemotaxis and virus expression.
23897640 We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for PLAUR
23874017 Soluble urokinase plasminogen activator receptor was identified in a majority of patients with focal segmental glomerulosclerosis as a soluble factor that acts through binding to and activating podocyte beta 3 integrin.
23843896 Elevated level of uPAR is detected in various aggressive cancer and contributs to tumor cell invasion and metastasis. [review]
23842190 Podocyte effacement is the first pathologic manifestation of FSGS after transplantation. The degree of podocyte effacement correlates with suPAR levels at time of diagnosis.
23835994 suPAR and the non-specific inflammatory markers CRP and PCT may have roles in development of community acquired pneumonia in children
23806081 A uPAR-dependent signaling pathway is required for CSE-induced EMT, which contributes to small airway fibrosis in COPD.
23747086 The reduced levels of Lp-PLA2 and suPAR in human carotid plaques of subjects on long-term treatment with beta-blockers suggest their possible protective role in plaque inflammation.
23742830 suPAR is an important biomarker that can predict infections in the early stage of febrile neutropenia with high sensitivity and NPV for patients with hematologic malignancies.
23736353 Studied serum and urine soluble uPAR from pretransplantation banked samples from 86 well-characterized kidney transplant recipients and 10 healthy controls to determine its prognostic utility.
23709605 Novel nonproteolytic signaling pathway initiated by single chain urokinase and mediated by domain 2 of uPAR, beta1-integrins, and VEGF receptor 2 leads to angiogenesis.
23667902 Overexpression of splice variant UPAR-del4/5 leads to reduced cell adhesion and invasion in breast cancer cells in a dose-dependent manner.
23565268 suPAR may help the objective assessment of asthma control, since it correlates with airway resistance and has good sensitivity in the detection of impaired asthma control.
23541763 PAI-1 and uPA expressions were changed in opposite directions in high invasive prostate cancer cell lines resulting in a strong decrease of PAI-1/uPA ratio.
23525268 Deacetylated GM3 enhances the metastatic phenotype by activating p38 signaling through uPAR/integrin signaling with FAK, PI3K, and Src kinase as intermediates.
23516493 NT-proBNP, CRP and suPAR levels were higher in black compared to white men
23512428 Higher soluble urokinase plasminogen activator receptor (PLAUR) levels indicate a poorer prognosis in gastric cancer patients.
23486467 sLR11 regulates the hypoxia-enhanced adhesion of HSPCs via an uPAR-mediated pathway that stabilizes the hematological pool size by controlling cell attachment to the BM niche.
23447064 Plasma PLAUR levels were significantly elevated in focal segemental glomerulosclerosis but did not distinguish primary from secondary disease.
23408042 Report role of urokinase plasminogen activator receptor in orchestrating the effects of plasminogen system on airway epithelial cell function.
23400595 Elevated levels of the urokinase plasminogen activation receptor is associated with highly aggressive breast cancer.
23327926 Importance of vitronectin and its interaction with the urokinase receptor in tumor growth.
23238745 UPAR, whose expression is regulated by uPA, can, in turn, regulate uPA expression through a mechanism involving its functional interaction with integrins and fMLF-Rs.
23222817 Highlighted the importance of uPAR and cathepsin B in the regulation of malignant stem cell self-renewal through hedgehog components, Bmi1 and Sox2.
23222509 Downregulation of uPAR and cathepsin B quenched TGF-beta1-driven invasion and survival of meningioma cells in a XIAP-dependent manner.
23180655 Single nucleotide polymorphisms in the RXRA and PLAUR genes in the vitamin D pathway may contribute to breast cancer disease free survival.
23172421 A novel role in doxorubicin-induced vascular damage via VSMC senescence is played by uPAR, which controls telomere function mediated by TRF2. uPAR affects TRF2 via Siah1-mediated ubiquitination & downregulation of proteasomal degradation.
23150653 Soluble uPAR in human carotid plaques and plasma is associated with the presence of symptoms and that plaque suPAR is associated with the vulnerable inflammatory plaque.
23138488 role in the pathogenesis of focal segmental glomerulosclerosis
23136192 Given the importance of FOXM1 in regulation of the expression of genes key to cancer biology, dysregulated expression and activation of FOXM1 may play important roles in colon cancer progression and metastasis.
23117033 Concentration of soluble urokinase-type plasminogen activator receptor is significantly increased in the blood of patients with pelvic inflammatory disease.
23076139 Simultaneous knockdown of both MMP-9 and uPAR regulated a majority of the molecules associated with glioma cell migration and significantly reduced the migration potential of glioma cells.
23049759 Ser90 is a critical residue for urokinase receptor-modulated cell migration and invasion signaling.
23033975 Data suggest that soluble urokinase plasminogen activator receptor (suPAR) might be an objective marker for identifying systemic lupus erythematosus (SLE) patients with active disease.
23030781 Multivariate survival analysis demonstrated that high levels of uPAR(I) were significantly associated with short overall survival in small cell lung cancer patients
22984561 apoptosis induced by knockdown of uPAR and MMP-9 is mediated by inactivation of EGFR/STAT3 signaling in medulloblastoma
22909410 Higher levels of CD87 were associated with increased risk for cardiovascular disease compared to the lower levels.
22906080 The detrimental effects of atherogenic LDL on VSMC are mediated by a decrease and delocalization of the UPA-UPAR interaction that result in an impairment of cytoskeleton dynamics and adhesion capacity affecting cell phenotype and function.
22896701 A flexible multidomain structure drives the function of the urokinase-type plasminogen activator receptor (uPAR).
22782499 urokinase receptor (CD87) represents a central mediator of growth factor-induced endothelial cell migration
22732587 A transgenic mouse C-type lectin domain family 9 (Clec9A)-diphtheria toxin receptor is developed that allows ablation of in vivo Clec9A-positive dendritic cells.
22702340 In papillary thyroid carcinoma BRAFV600E is associated with increased expression of the urokinase plasminogen activator and its cognate receptor, but not with disease-free interval.
22633212 suPAR does not seem to be a useful biomarker in the AAA disease.
22577342 our studies indicated that uPAR plays a significant role in ovarian cancer
22487523 We have identified three potential invasive markers, uPA, MMP-1 and IL1-R1, whose gene expression may differentiate PDAC from other pancreatic neoplasms.
22470492 The downregulation of uPA/uPAR results in increased integrin alphavbeta5 cell-surface protein levels that regulate the activity of beta1 integrins, promoting characteristics of the persistent Myofibroblasts.
22467324 uPA, uPAR, and PAI-1 were quantified by enzyme-linked immunosorbent assay (ELISA) in extracts of 226 breast tumor biopsies.
22459389 Plasma levels of PLAUR, but not C-reactive protein, is robustly and significantly related to the extent of carotid plaques in atherosclerosis.
22366462 uPAR rapidly activated RhoB and increased RhoB expression.
22363796 uPAR is dispensable for nerve development, whereas, loss of uPAR affects nerve regeneration.
22298164 Simvastatin and atorvastatin attenuate VCAM-1 and uPAR expression on human endothelial cells and platelet surface expression of CD40 ligand.
22287577 uPAR is an essential component of the network through which VEGF controls integrin redistribution and endothelial cell migration.
22199285 Resveratrol reduces TNF-alpha-induced U373MG human glioma cell invasion through regulating NF-kappaB activation and uPA/uPAR expression
22177802 Small hairpin RNA against uPA and/or uPAR increased secretion of TIMP-1, which is known to enhance SVEGFR1 secretion in endothelial cells and glioblastoma cells.
22139533 The uPAR pathway is required for efficient epithelial wound repair. Increased uPAR expression, leads to weak wound repair which may contribute to the development and progression of airway remodelling in asthma.
22119508 Elevated levels of soluble UPAR are, independently of established cardiovascular risk factors, associated with an increased incidence of CVD in elderly subjects.
22113150 Africans had higher levels of soluble UPAR and arterial stiffness than Caucasians (p<0.001), but there was no independent relationship between arterial stiffness and soluble UPAR in the Africans.
22098627 Serum suPAR is a potential novel biomarker for the diagnosis of cirrhosis, identification of alcoholic origin and for determining prognosis in patients with chronic liver disease.
22075245 uPAR, a glycosylphosphatidylinositol-anchored cell-surface receptor family member, undergoes ligand-induced internalization and nuclear transport in vascular smooth muscle cells.
22025616 Data argue for a biological relevance of the interdomain dynamics of the glycolipid-anchored uPAR on the cell surface.
22004682 down regulation of uriokinase plasminogen activator (uPA) or uPA receptor results in the inhibition of glioma cell invasion via inhibition of Notch 1 receptor cleavage, signaling and endosomal trafficking of the Notch 1 receptor
21945852 Data suggest that combination treatment with radiation and uPAR knock down or Chk2 inhibitor resulting in non-reversible G2/M arrest may be beneficial in the management of meningiomas.
21934527 serum levels of suPAR, a component of the fibrinolytic cascade, are strongly associated with progressive liver fibrosis in HCV infection.
21896743 Data show that uPAR and its crosstalk pathways with EGFRvIII emerge as logical targets for therapeutics development in GBM.
21848504 Neither UPARwt, nor UPAR-del4/5 nor RAB31 mRNA expression levels were found to be prognostic markers in advanced ovarian cancer.
21840777 Cathepsin B and uPAR downregulation reduced tumor growth and increased p27 nuclear expression in vivo.
21833477 These results indicate that urokinase plasminogen activator, plasminogen activator urokinase receptor and maspin expression patterns may be useful markers for evaluating the clinical course or prognosis of oral squamous cell carcinoma patients
21804539 Circulating urokinase receptor is a cause of focal segmental glomerulosclerosis.
21803847 Endothelial progenitor cell-dependent angiogenesis requires localization of the full-length form of uPAR in caveolae.
21799009 The inherent interdomain mobility in uPAR plays a major role in modulating its function.
21761413 No association between uPAR (rs344781) polymorphism and endometrial carcinoma risk
21744990 High U-PAR expression is associated with poor treatment response in colorectal carcinoma.
21711960 increased expression in sinonasal mucosa of chronic rhinosinusitis patients with polyps
21702998 Results suggest that PAI-1 and uPAR-del4/5 mRNA levels may add prognostic information in STS patients with R0 status.
21638078 There is a negative prognostic influence of the expression of CD87 on the surface of acute myeloid leukemia blasts
21630091 These data shed light on a molecular mechanism whereby acquisition of uPAR expression may modulate oral squamous cell carcinoma invasive activity through alteration of focal adhesion dynamics.
21602447 This work provides a first direct demonstration of the dimerization of uPAR in live cells, and provides the first methodoligcal guide on number and brightness analysis to discern minor changes in molecular composition.
21544310 differential binding and signalling between the cleaved and uncleaved forms of kininogen
21478092 Concentrations of urokinase plasminogen activator (uPA) in induced sputum of asthma patients after allergen challenge.
21470685 uPAR expressed on neutrophil plasma membrane regulates transendothelial migration.
21470667 There was no statistically significant difference in serum uPAR levels between the patients with Behcet's disease and the control subjects.
21456072 uPAR forms are promising prognostic and predictive markers in prostate cancer.
21426933 The targeting uPAR not only inhibited established intracranial tumors but also radiation-induced recruitment of endothelial cells and monocytes towards the tumor region.
21419107 miR-10b induced glioma cell invasion by modulating tumor invasion factors MMP-14 and uPAR expression via the direct target HOXD10
21391216 We found a significant correlation of HER2 with human epidermal growth factor receptor 3 (HER3/erbB3), epidermal growth factor receptor 1 (EGFR/HER1/erbB1) and urokinase plasminogen receptor (uPAR) in breast cancer tissues.
21354571 Soluble UPAR was associated with subclinical organ damage, but predicted cardiovascular events independent of subclinical organ damage and traditional risk factors.
21304107 DEP-1 (density enhanced phosphatase-1/CD148), which is abundantly expressed in confluent endothelial cells, inhibited the VEGF-dependent activation of ERK1/2, leading to down-regulation of uPAR expression
21224999 urokinase-type plasminogen activator is overexpressed in pterygia and pterygium fibroblasts
21191179 Downregulation of urokinase plasminogen activator receptor leads to induction of papillary thyroid carcinoma cell senescence.
21181094 Anti-tumor efficacy of down-regulation of uPA or uPAR in medulloblastoma tumors to target hypoxia-induced cell EMT, invasion and migration, to achieve better therapeutic outcomes in the treatment of malignant medulloblastoma.
21148633 Data show that siRNA in combination with IR effectively reduced both MMP-9 and uPAR expression, thereby leading to increased radiosensitivity of medulloblastoma cells.
21106716 The study demonstrated that in papillary thyroid cancer the increased gene expression of uPA and uPAR is associated with tumor invasiveness
21106094 Cholesterol levels in lipid rafts are critical for the migration, invasion, and angiogenesis of breast carcinoma cells and could be a critical regulatory factor in these cancer cell processes mediated by uPAR and MMP-9.
21088115 uPAR might guide/control the trafficking of mesenchymal stem cells to the injured vascular wall and their differentiation towards functional smooth muscle cells.
21081472 results suggest that MSP induces uPAR expression via MAPK, AP-1 and NF-kappaB signaling pathways
21060833 RNAi-mediated downregulation of uPAR and cathepsin B initiates caspase-dependent mitochondrial apoptosis in U251 cells and caspase-independent mitochondrial apoptosis in 5310 cells
20972812 Results show that uPAR expression regulates the adhesive and migratory ability of CXCR4-expressing cells through a mechanism involving fMLP receptors and alpha-v integrins.
20967855 The UPAR rs344781 gene variant is associated with the systemic sclerosis vascular phenotype.
20967855 Observational study of gene-disease association. (HuGE Navigator)
20937265 role of single nucleotide polymorphism of uPA and uPAR in non-small cell lung cancer
20937265 Observational study of gene-disease association. (HuGE Navigator)
20886176 Results suggest that uPAR plays a pivotal role in the development of adipose tissue through PI3K/Akt pathway.
20858596 The FOXP2-SRPX2/uPAR network provides exciting insights into molecular pathways underlying speech-related disorders.
20840675 In invasive breast cancer uPAR expression in invasive carcinoma cells, but not in stromal cells, has a significant impact on patients' prognosis, and contributes to a more aggressive tumour phenotype.
20805979 uPA/uPAR downregulation suppresses angiogenesis in endothelial cells induced by glioblastoma cell lines
20696135 hSpry1 and HAX1 proteins are putative candidate proteins that interact with uPAR.
20693875 A noninvasive in vivo fluorescence-mediated tomography technique is used to image leukocyte recruitment in an inflammatory mouse model that quantifies a novel macrophage recruitment defect in u-PAR-deficient mice.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20661471 Findings provide molecular mechanism for the G0/G1 arrest induced by the downregulation of cathepsin B and uPAR in SNB19 and U251 glioma cells.
20648659 Increased expression of uPAR in surgical specimens of human frontal cortex may be associated with intractable epilepsy.
20635136 demonstrate that the uPAR-del4/5 mRNA splice variant mediates tumor-relevant biological processes in vitro and in vivo
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624254 Levels of uPAR, PAI-1 and CAP18 were elevated in induced sputum of COPD I + II and COPD III + IV patients, compared with those of healthy non-smokers and healthy smokers.
20580686 uPAR acts as a cofactor for iC3b binding to CR3 and regulates CR3-mediated phagocytosis.
20558828 Increased uPAR expression induced by anti-Ro60 binding to the apoptotic fetal cardiocyte provide a molecular basis by which these antibodies inhibit efferocytosis and lead to scar of the fetal conduction system.
20518747 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20447686 Observational study of gene-disease association. (HuGE Navigator)
20403162 Demonstrate increased expression of uPA and uPAR in human seminomas with respect to normal testis tissues, which may be relevant in testicular cancer progression.
20372789 the interaction between urokinase receptor and heat shock protein MRJ enhances cell adhesion
20237496 Observational study of gene-disease association. (HuGE Navigator)
20198323 A combination approach using uPA and uPAR siRNA therapy along with radiation treatment produced target-specific effects with regard to inducing apoptosis in meningioma.
20145038 Increased uPAR expression promotes alpha(3)beta(1) integrin association, resulting in increased mitogen-activated protein kinase signaling and transcriptional activation, leading to the formation of more aggressive tongue tumors.
20142364 During melioidosis, uPAR contributes to the recruitment of neutrophils to the primary site of infection and the capacity of neutrophils to phagocytose Burkholderia pseudomallei.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20063318 Simultaneous downregulation of HER2 and uPAR may offer an effective tool for breast cancer therapy.
20051950 As expression of members of the uPA system in tumour tissue and serum is additively correlated with prognosis of soft tissue sarcoma patients.
20012874 expession is associated with hair follicule morphogenesis and cell migration
19913121 Observational study of gene-disease association. (HuGE Navigator)
19908229 analyzed the role of Spred2 in the urokinase-type plasminogen activator (uPA) stimulation, EMT and cell migration by TGF-beta1
19878584 This study provides tentative evidence that the asthma associated gene PLAUR also influences baseline lung function in smokers
19878584 Observational study of gene-disease association. (HuGE Navigator)
19796867 CRG2 regulates invasion/migration partly through ECM degradation and uPA/uPAR/FPRL1 pathway
19782465 lithocholic acid induces uPAR expression via Erk-1/2 and AP-1 pathway and, in turn, stimulate invasiveness of human colon cancer cells.
19756998 Neutrophils contribute to or are responsible for the generation of increased suPAR levels during the inflammatory response and, release the chemotactically active form of suPAR that might be involved in lymphocyte recruitment into the inflamed tissues.
19740518 uPA, but not uPAR, is an independent prognostic factor and that this negative effect on survival is relevant specifically for mismatch repair-proficient colorectal cancers.
19717562 ECRG2 is involved in the regulation of cell migration/invasion through uPA/uPAR/beta1 integrin pathway.
19693769 3,3'-Diindolylmethane (B-DIM) down-regulates uPA-uPAR in aggressive breast cancers but in the absence of uPA-uPAR, B-DIM can directly inhibit VEGF and MMP-9 leading to the inhibition of cell growth and migration of breast cancer cells
19691446 uPAR-mediated VSMC differentiation employs lipid rafts.
19642359 Abnormally high levels of Annexin II and u-PAR expression in acute promyelocytic leukemia cells may contribute to the increased production of plasmin, leading to primary hyperfibrinolysis.
19638192 Protein analysis confirmed expression of multiple different forms of urokinase plasminogen activator receptor (UPAR) in the same cells as well as expression of soluble uPAR in cell supernatants
19635932 Link overexpression of uPAR to the pathogenesis of malignant pleural mesothelioma, and demonstrate that this receptor contributes to accelerated tumor growth in part through interactions with uPA.
19616049 Soluble urokinase receptor conjugated to carrier red blood cells binds latent pro-urokinase and alters its functional profile.
19609941 Data show that uPAR expressed in macrophages and neutrophils in all cases.
19546228 These results demonstrate that uPAR-initiated cell signaling may be targeted to reverse EMT in cancer.
19497996 uPAR may promote cancer metastasis independent of uPA.
19480010 High u-PAR-gene expression is associated with thyroid neoplasms.
19475533 Tumor stroma is the predominant UPAR-expressing tissue in human breast cancer: prognostic impact is reported.
19472211 Plasminogen activator inhibitors regulate cell adhesion through a uPAR-dependent mechanism.
19461880 study shows that uPAR is upregulated upon exposure to B. burgdorferi; uPAR plays an important role in phagocytosis of B. burgdorferi by leukocytes
19443353 study demonstrated that uPA and PAI-1 are useful predictors of distant metastases in a subset of early stage, node-negative breast cancer patients
19443020 This study represents the first report to identify PLAUR as a potential asthma susceptibility gene and determine PLAUR regions underlying this association, including a role in influencing plasma PLAUR levels
19436306 LPS promotes tumour cell ECM adhesion and invasion through activation of the u-PA system in a TLR-4- and NF-kappaB-dependent manner.
19435784 uPAR gene amplifications identify a subgroup of particularly aggressive tumors
19433314 siRNA to uPAR significantly inhibited cell proliferation and migration and stimulated apoptosis, to a greater extent than uPA siRNA.
19411312 u-PAR may interact with multiple integrins in normal human lung fibroblasts thereby promoting attachment, spreading, and migration.
19404710 the expression levels of u-PAR in peripheral blood and bone marrow evaluated preoperatively indicate the potential of breast cancer to relapse or metastasize after surgery.
19403319 the 20-26 amino acid residues of uPA are important for the binding between uPA and uPAR, and that the electrostatic interactions between the charged amino acid residues existing in both uPA and uPAR have large contribution to the binding
19383607 role of uPAR in the phagocytosis of apoptotic cells
19298527 survivin is an essential mediator of arthritogenic properties of uPA regulating its synthesis in synovial fibroblasts and uPAR expression in leucocytes
19177204 uPAR is under transcriptional control of HIF and that this is important for hypoxia-induced metastasis
19176991 Urokinase & its receptor UPAR exert a regulatory effect on physiologic cell migration as well as tumor growth and metastasis. Review.
19157142 The positive expression of uPA and uPAR in hypopharyngeal carcinoma were significantly higher than in normal tissue.
19123477 analysis of urokinase, urokinase receptor and plasminogen activator inhibitor-1 in colon cancer liver metastases
19117638 Observational study of gene-disease association. (HuGE Navigator)
19115132 The higher expression of uPAR/uPA in most of the opportunistic cerebral lesions supports their role in these diseases, suggesting their contribution to tissue injury.
19088796 Data show the effects of nitric oxide and hydrogen peroxide on the expression of tissue-type plasminogen activator (t-PA), urokinase-PA, u-PA receptor, and plasminogen activator inhibitor type 1 (PAI-1) in human umbilical vein endothelial cells.
19050704 study evaluated the expression level of uPAR mRNA and the presence of isolated tumour cells in bone marrow and peripheral blood in gastric cancer patients and clarified its clinical significance
19037107 M6P/IGF2R controls cell invasion by regulating alphaV integrin expression and by accelerating uPAR cleavage, leading to the loss of the urokinase/vitronectin/integrin-binding site on uPAR.
19020743 EGF induces uPAR expression via ERK-1/2, AP-1, and NF-kappaB signaling pathways and, in turn, stimulates cell invasiveness in human gastric cancer AGS cells
19017363 NYD-SP8 has a role in regulating ECM degradation, providing a novel mechanism that modulates urokinase signalling in the suppression of cancer progression
19008962 These results indicate that, in addition to the ligand-induced endocytosis of uPAR, efficient surface expression and membrane trafficking might also be driven by an uncommon macropinocytic mechanism coupled with rapid recycling to the cell surface.
18957516 Caveolin-1 plays a dual role in the fibronectin assembly regulated by uPAR signaling.
18954937 suPAR, prevents the interaction of urokinase with membrane-anchored uPAR on residual normal cells.
18953252 Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding.
18949356 uPA/uPAR downregulation inhibits radiation-induced migration, invasion and angiogenesis in IOMM-Lee meningioma cells and decreases tumor growth in vivo.
18941116 either uPA/uPAR interaction, Mac-1 activation, or prevention of its association with uPAR triggers a signaling pathway leading to the inefficient release of HIV from monocytic cells
18940913 uPAR and beta1-integrin interactions are essential to signals induced by integrin matrix ligands or uPA in lung cancer cells.
18830568 Data suggest that production of the active form of suPAR by neutrophils may contribute to the recruitment of monocytes and other cells to the sites of acute inflammation where neutrophil accumulation and activation occur.
18819934 Enhanced expression of urokinase-type plasminogen activator receptor is associated with the invasion of glioblastoma.
18813852 The aim of this study was to investigate whether UPAR co-localises with macrophages in symptomatic carotid plaques, and whether UPAR expression is associated with plaque rupture.
18813792 the simultaneous downregulation of uPAR and MMP-9 induces apoptosome-mediated apoptosis through FADD-associated protein RIP and caspase 9
18808175 Differential proteome expression is associated with UPAR suppression in malignant epithelial cancer.
18788551 uPA and uPAR in the synovial fluid may play a role in the pathogenesis of temporomandibular disorders.
18762175 Free fatty acids modify the expression for uPAR in the PMA-differentiated human monocyte/macrophage-like cell line U937.
18725541 uPAR cooperates with integrin complexes containing beta(3) integrin to drive formation of the p130Cas-CrkII signaling complex and activation of Rac, resulting in a Rac-driven elongated-mesenchymal morphology, cell motility, and invasion.
18718938 Interaction of SRPX2 with uPAR involved in the functioning, the development and disorders of the speech cortex.
18691743 the plasma levels of uPA and uPAR are closely related to the degree and period of inflammation in patients with acute or chronic hepatitis B, and that uPA and uPAR might be important indicators for disease progression
18673553 urokinase-type plasminogen activator receptor has a role in oral squamous cell carcinoma
18644795 analysis of conformational changes in the alpha(M)beta(2) headpiece and reorientation of its transmembrane domains when alpha(M)beta(2) interacts with uPAR
18599586 Report increased expression of uPAR by Helicobacter pylori in gastric epithelial cells.
18511987 distribution of genotypes and frequencies of alleles of the (CA)(n) repeat polymorphism in intron 3 of the uPAR gene, uPAR antigen levels and microvessel density in tumour and distant mucosa samples from 52 patients with colorectal cancer
18508599 Role of the serine protease urokinase-type plasminogen activator and its high affinity receptor uPAR/CD87 in chronic kidney disease [REVIEW].
18508598 The structural biology of uPAR is reviewed with special emphasis on its multidomain composition and the interaction with its natural protein ligands
18487955 UPAR mediates anticancer activity of PEDF.
18376415 reports the crystal structures of uPAR in complex with both urokinase (uPA) and vitronectin and reveal that uPA occupies the central cavity of the receptor, whereas vitronectin binds at the outer side of the receptor
18362146 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18328568 suPAR associated to important glucose metabolic aberrations in HIV-infected patients on HAART; suPAR was stable after a glucose challenge
18315930 The change of plasma suPAR level in multiple myeloma contributes to predict the development and prognosis of the disease.
18257282 The plasma uPAR and uPA levels in nosebleed patients before treatment is higher than that in normal group.
18247343 the urokinase-type plasminogen activator receptor is upregulated by lysophosphatidic acid in human gastric cancer cells
18097558 suPAR, a soluble form of urokinase plasminogen activator receptor, inhibits human prostate cancer cell growth and invasion.
18095109 The expression of constitutively activated RelA/NF-kappaB is associated with malignancy potential in astrocytic tumors and may play a critical role in the regulation of u-PA expression and invasiveness in gliomas.
18084301 uPAR is required to activate alphavbeta3 integrin in podocytes, promoting cell motility and activation of the small GTPases Cdc42 and Rac1
18056417 The data demonstrate that cell surface protein assemblies are important in regulating the dynamics and localization of uPAR at the cell membrane and the exchange of monomers and dimers.
18048089 The carotid atherosclerosis is independently related to uPA/its soluble receptor system in dialysis patients
18029284 elevated in polycystic ovary syndrome
18021410 Plasma suPAR levels, as measured by the suPARnostic(R) assay, were strongly predictive of survival in ART-naive HIV-1 infected patients. Furthermore, plasma suPAR levels were not influenced by uPAR promoter polymorphisms.
17963689 The role of the ligand uPA on uPAR localization and on the composition of the lipid membrane microdomains, is studied.
17952591 uPAR-del4/5 and rab31 mRNA represent independent prognostic markers in breast cancer and may be components of different, but possibly associated, tumor-relevant signaling pathways.
17880283 review of uPA - uPAR interactions with membrane proteins to modify signal transduction pathways and their role in oral squamous cell carcinoma
17706320 High tumour cell C4.4A expression is associated with shorter survival for non-small cell lung cancer patients.
17664334 Results suggest that in hypoxia, uPAR activates diverse cell signaling pathways that cooperatively induce epithelial-mesenchymal transition and may promote cancer metastasis.
17549401 Simultaneous down-regulation of uPAR and uPA induced caspase-8 mediated apoptosis.
17548516 A direct uPAR-vitronectin interaction is both required and sufficient to initiate downstream changes in cell morphology, migration, and signal transduction.
17548471 These observations demonstrate a novel regulatory role for p53 as a uPAR mRNA binding protein that down-regulates uPAR expression, destabilizes uPAR mRNA, and thereby contributes to the viability of human airway epithelial or lung carcinoma cells.
17523079 Altered expression of UPAR was observed in high-risk soft tissue sarcomas.
17517866 LasB is able to cleave uPAR both within the sequence linking D1 to D2 and at the carboxy terminus of D3.
17510314 These data suggest that Src-induced u-PAR gene expression and invasion/intravasation in vivo is also mediated via AP-1 region -190/-171, especially bound with c-Jun phosphorylated at Ser(73/63).
17507651 These data support a novel hypothesis that maintaining full-length uPAR on the cell surface regulates the fibroblast to myofibroblast transition and that down-regulation of uPAR is necessary for myofibroblast differentiation.
17487556 forced expression of urokinase receptor coupled with exogenous addition of urokinase restored migration of CTR-knock-down spheroids.
17427199 ERK cascade regulates motility of hepatocellular carcinoma cells via uPAR production and p70S6K phosphorylation.
17344041 PLAUR and the somatomedin B region of VTN direct the localization of UPA to focal adhesions in microvessel endothelial cells.
17330942 uPAR behaves as a lynchpin in promoting tumorigenesis by forming functionally active multiprotein complexes.
17327908 uPA and uPAR are involved in generation of drug-resistant small-cell lung cancer cell phenotype. uPAR-positive cells may define a functionally important population of cancer cells in SCLC.
17319000 uPAR of cancerous cells was more often observed in lobular carcinomas.
17297470 These data suggest Pdcd4 as a new negative regulator of intravasation, and qas the invasion-related gene u-PAR. It is the first study to implicate Pdcd4 regulation of gene expression via Sp1/Sp3.
17264329 Elevation of plasma uPA and uPAR levels in CaP patients are partly caused by local release from the prostate. Plasma levels of uPA and uPAR are associated with biologically aggressive CaP, disease progression after radical prostatectomy, and metastasis
17237151 Proteolytic regulation of uPAR by airway trypsin-like kinase is likely to modulate cell adherence and motility, as well as tissue remodeling during the inflammatory response in the airways.
17145753 Urokinase receptor (uPAR) is required for maximal alpha5beta1 integrin-dependent responses to fibronectin that promote tumor cell invasion.
17101149 Pro188, Asn190, Gly191, and Arg192 residues of uPAR are the key residues for the antibody recognition, while Pro189 and Arg192 render specificity of ATN615 for human uPAR
17079488 Expression of HER-2 and uPAR in primary tumors predicted gene status in 100 and 92% of patients, respectively
17028265 uPAR expression of lung airway epithelial cells is regulated at the level of mRNA stability by inhibition of protein tyrosine phosphatase-mediated dephosphorylation of uPAR mRNA binding proteins and demonstrate that the process involves SHP2.
17001307 A novel intragenic enhancer in the u-PAR gene required for constitutive and inducible expression was defined.
16949925 study shows uPA & uPAR are overexpressed in primary prostate cancer cells & surrounding stromal cells (Gleason score >/=7) & more than 90% lymph node metastases but not in normal prostate, benign prostate hyperplasia or prostatic intraepithelial neoplasia
16912170 uPAR cell surface density may be a contributory factor in colon cancer progression.
16905120 Data suggest that the function of alphaMbeta2 integrin domain and integrin-like domain is disrupted, possibly by stearic shielding, by uPAR when both uPAR and alphaMbeta2 integrin molecules interact.
16893520 aspirin upregulates steady-state level expression of uPAR mRNA as well as expression of uPAR protein.
16858643 urokinase-type plasminogen activator (uPA) and its soluble receptor may not have roles in progression of atopic eczema/dermatitis syndrome, as plasma levels of uPA and suPAR are similar in patients at different stages of AEDS and healthy subjects
16756681 Novel pathway for uPAR regulation involving reactive oxygens such as superoxide anion.
16685436 Intratumoral injections of the plasmid vector expressing siRNA for uPAR resulted in regression of pre-established, subcutaneous meningioma tumors.
16632475 ligand engagement of uPAR promotes cell survival by activating Bcl-xL transcription through the MEK/ERK- and phosphatidylinositol 3-kinase/Akt-dependent pathways
16601839 endothelial progenitor cells are characterized by high intrinsic uPA/uPAR-dependent proteolytic potential that could contribute to their invasive and angiogenic behaviour
16564525 These results suggest that low glucose levels in malignant cancers increase tumour cell invasiveness by stimulating urokinase plasminogen activator and plasmin activity.
16525631 Results clearly suggest the involvement of the uPA-uPAR system in cell survival and proliferation in addition to their role in tumor progression.
16516155 In situ hybridization revealed a strong expression signal for SGRG in spermatogonia, but not in spermatocytes.
16510444 This study supports matrix-induced clustering of alpha3beta1 integrin promotes uPAR/alpha3beta1 interaction; potentiating cellular signal transduction pathways culminating in activation of uPA expression and enhanced uPA-dependent invasive behavior.
16504015 IL-1alpha can induce selective upregulation of alpha6beta1-integrin and uPA/uPAR in pancreatic cancer cells and these changes may modulate the aggressive functions of pancreatic cancer.
16497155 Here we demonstrate uPAR is a target for tissue kallikrein 4[hK4], cleaved in the D1-D2 linker and D3 domain. hK4 may modulate tumor-associated uPA/uPAR activity by activating the pro-enzyme form of uPA or cleaving the cell surface-associated uPA receptor
16467878 These results demonstrated that uPAR is induced by hypoxia and that increased uPAR expression is mediated by ERK phosphorylation, which in turn is modulated by iNOS/NO in MDA-MB-231 cells.
16456079 crystal structure at 1.9 angstroms of the urokinase receptor complexed with the urokinase amino-terminal fragment and an antibody against the receptor
16395714 Our results suggest that PAI-1 is a novel potential marker of initial invasion in oral SCC, and that the coordinated expression of PAI-1 with uPAR and lam-gamma2 sustain the features of the early invasive cancer cells.
16267271 Both wild-type (wt) and human cleavage resistant-uPAR are able to mediate uPA-induced migration, are constitutively associated with the EGFR, and associate with alpha3beta1 integrin upon uPA binding
16216813 The uPAR-associated protein up-regulation is involved in the process of extracellular matrix proteins degradation and HUVEC cell-migration.
16127174 a complex signaling network operating downstream of uPA-uPAR actively advances tumor cell invasion, proliferation, and survival of prostate cancer cells
16077991 Urokinase plasminogen activator receptor is overexpressed in renal cell carcinoma and could function as tumour marker.
16010978 A novel mechanism of uPAR gene regulation in lung epithelial cells was shown in which cis elements within a 110 nt uPAR mRNA 3'UTR sequence interact with hnRNPC to regulate uPAR mRNA stability.
15951330 uPAR mRNA binding activity as well as PGK-mediated regulation of uPAR mRNA are independent of PGK enzymatic activity
15922359 specific streptococcal surface protein-pharyngeal cell receptor interaction mediated by Streptococcal surface dehydrogenase and uPAR is modulated during group A Streptococcus infection
15894933 Expression in noninvasive tumors suggests that uPAR may have other biologic functions in addition to promotion of tumor invasion.
15885322 The level of urokinase-type plasminogen activator receptor (uPAR) does not correlate with cerebrospinal fluid to serum albumin ratio, suggesting an unimportant role for uPAR in HIV-induced blood-brain-barrier disruption.
15866865 urokinase receptor-derived SRSRY peptide regulates cross-talk between fMLP and vitronectin receptors
15863511 Domain 2 of the urokinase receptor plays a pivotal role in the regulation of uPAR-integrin alphavbeta3 interactions
15851910 Plasma levels of different forms are incsreased and associated with immune activation in HIV patients, and are an independent predictors of mortality in these patients.
15849776 UPA-R positivity may identify subtypes of acute myeloid leukemia and thus a more intensive induction therapy regimen could be considered.
15841307 review of mechanisms by which uPAR participates not only in the modulation of cell-cell and cell-extracellular matrix interactions, but also in the control of extracellular signals determining the proliferative state of a cell
15831288 basic capacity of separated epithelial and stromal cells from all three types of tissue to release uPA, PAI-1, and suPAR without any paracrine influence, as in vivo
15824107 uPAR and MMP-9 have roles in inhibiting cell proliferation and can reduce the levels of phosphorylated forms of MAPK, ERK, and AKT signaling pathway
15728176 expression and assembly of uPAR co-receptors in a specific cell type determines the response to uPA
15711734 review of signal transduction and events linking the uPA/uPAR system to cell growth and apoptosis
15684035 Direct binding of uPAR with alpha5beta1 implies a modified "bent" integrin conformation can function in an alternative activation state with this and possibly other cis-acting membrane ligands.
15677461 urokinase receptor proteolytic function is regulated by the tetraspanin CD82
15573379 uPAR plays a key role in promoting macrophage infiltration into the arterial wall of ApoE(-/-) mice
15543615 importance of uPAR to define higher risk subgroups of breast cancer patients with micrometastatic disease
15521066 These findings suggest that AdCC has a proclivity for migrating to types I and IV collagens due to the overexpression of uPAR, which plays a key role in focal adhesion assembly and migration.
15515049 uPAR immunoreactivity correlated with the mRNA expression and was, in addition, found in neutrophils in prostttic cancer.
15494526 Human basophils express the urokinase receptor on their surface in both the intact (domains D1D2D3) and the cleaved (D2D3) form.
15494432 G-CSF-induced upregulation of uPAR on circulating CD33+ and CD14+ cells, increased uPAR shedding & serum c-suPAR, which could contribute to the mobilization of HSCs by promoting their FPR-mediated migration and by inducing CXCR4 desensitization.
15381392 gene expression of the uPAR and underlying mechanisms were analyzed during the development of atherosclerosis in the aorta of apolipoprotein E-deficient mice
15375521 Increased expression of plasminogen activator, urokinase receptors is associated with transitional cell carcinoma of the human bladder
15358545 cleavage of juxtamembrane domain by plasmin
15326109 uPA/uPAR ligation anchors the complex to the actin cytoskeleton and is a part of the mechanism responsible for uPA-induced cell migration in fibroblasts.
15302576 Antisense to uPAR significantly restricted invasion of the highly invasive DU145 WT cells through Matrigel and reduced aggressiveness of tumors in nude mice.
15285727 Amounr is significantly increased during storage of blood transfusion components, an accumulation that is reduced using pre-storage leucofiltration.
15248186 Any alterations in the domain structure of uPAR reduce its expression.Only the intact receptor with all 3 domains can sustain the direct cell adhesion on vitronectin-rich matrices found at sites of inflammation and injury.
15243126 Data describe the cyclic variation and distribution of urokinase plasminogen activator (uPA), uPA receptor and plasminogen activator inhibitor 1 (PAI-1) mRNA in normal endometrium.
15188055 the promoter region of uPAR from -136 to +9 may interact with relevant nuclear factors, resulting in various levels of uPAR expression
15182581 TF/FVIIa complex up-regulates the transcription of u-PAR in human ovarian cancer cells.
15122709 Overexpression of uPAR in the central nervous system of patients with AIDS dementia suggests that the uPA/uPAR system may contribute to the tissue injury and neuronal damage in this disease.
15044324 uPAR forms a signaling complex containing integrin alpha(v)beta3 or alpha5beta1, caveolin, & Src kinase Yes in endothelial cells. uPAR is a target of HKa activity at the endothelial cell surface.
15042374 demonstrated focused activation of proteolytic enzymatic activity in several cell types and showed that the uPA/uPAR system is an important contributor to focal pericellular proteolysis
15032076 Data indicate that uPAR is potentially an important prognostic factor in bladder carcinoma.
15031672 Results suggest that hypoxia increases tumor cell invasion by up-regulating urokinase plasmalogen activator receptor expression, possibly through ERK and p38 kinase signaling pathways.
15031282 KLF4 is a novel regulator of u-PAR expression that drives the synthesis of u-PAR in the luminal surface epithelial cells of the colon
14995994 Western blotting of endothelial cell surface of a number of sites showed higher amounts of tissue plasminogen activator annexin II on cerebral endothelial cell. In contrast, expression of u-PA receptor was the same for all ECs
14961171 enhanced levels of suPAR fragments in the urine of cancer patients is likely to originate from uPAR expressed in the tumour tissue
14764427 These results demonstrate that phosphoglycerate kinase regulates uPAR expression at the post-transcriptional level.
14729600 Irradiation induced tumor hypoxia, and tumor hypoxia induced up-regulation of uPAR in human melanoma xenografts in nude mice.
14702177 IL-1-induced expression of UPAR and its co-localization with MMPs were studied in articular chondrocytes.
14668033 MMP-9 and su PAR levels might be used as a marker for disease activity and may contribute to blast cell dissemination. MMP-9 and suPAR may be target molecules in the strategy of treatment of AML.
14660675 up-regulation of uPAR expression by Bcl-2 in hypoxia is modulated by Sp1 DNA binding activity through the ERK signaling pathway
14602715 uPAR and integrin receptors synergistically regulate the levels of fibronectin in the extracellular matrix
14601049 uPAR plays an active role in breast cancer metastasis and may therefore be a promising target for new biologic therapies.
14563447 role of urokinase plasminogen activator receptor (uPAR) and c-erbB-2 in breast and ovarian cancer
14531820 uPA and uPAR are up-regulated during acute renal allograft rejection
14520707 Reduced expression of urokinase plasminogen activator receptor is associated poorly differentiated ovarian tumors and metastases
14517288 urokinase and urokinase receptor mRNAs are stabilized by HuR linked to its cytoplasmic accumulation induced by activated mitogen-activated protein kinase-activated protein kinase 2
14507113 Significant increases in uPAR were found in pretreatment determinations of patients with advanced small-cell lung cancer or non-small-cell lung cancer.
14500474 signaling for the uPAR response, as mediated by B. burgdorferi, proceeds with CD14 and TLR2 as partial contributors
12960238 predictors of human immunodeficiency virus (HIV) disease progression (review)
12952933 Results suggest that Endo180 is a crucial link between urokinase-type plasminogen activator and its receptor and setting of the internal cellular compass.
12933356 Results suggest that uPAR can engage distinct signaling pathways involving different partner proteins that are functionally and physically segregated from one another in both lipid raft and non-raft domains of the plasma membrane.
12881310 data indicating that the structure of the kringle as well as its interaction with the growth factor domain govern urokinase binding to the urokinase receptor
12761227 urokinase receptor D2 contains two distinct ligand binding sites for urokinase-type plasminogen activator and vitronectin
12736046 Plasma uPAR levels are greater in those with bladder cancer than in healthy subjects (P <0.001) and greatest in patients with metastases to distant lymph nodes (P = 0.042).
12708473 The expression of uPAR was significantly correlated with gastric tumor size, depth, lymph node involvement, differentiation & vascular invasion.
12704669 uPAR expression in lung cancer is regulated at a posttranscriptional level by uPA
12665524 the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms.
12665127 uPAR up-regulated the Mac-1 adhesion to fibrinogen, and focal adhesion kinase and MAPK were involved in this regulation
12479856 The diphtheria toxin/urokinase fusion protein (DTAT) is selectively toxic to CD87 expressing leukemic cells, showing that specific CD87 binding is one factor important in the sensitivity of patient's leukemic blasts to DTAT
12405290 correlates with cox2 expression levels and is responsible for poor prognosis of colorectal cancer
12393744 Urokinase receptor surface expression regulates monocyte adhesion in acute myocardial infarction
12393547 recognition of uPA by alpha(M)beta(2) allows for formation of a multicontact trimolecular complex, in which a single uPA ligand may bind to both uPAR and alpha(M)beta(2); interaction of uPA with each receptor influences cell adhesion and migration
12376466 seprase and the urokinase plasminogen activator receptor (uPAR), co-localize in the plasma membrane of LOX malignant melanoma cells
12297505 uPA-mediated uPAR cleavage and D1 removal, occurring on the cell surface of several cell types, can play a fundamental role in the regulation of multiple uPAR functions
12244126 Mutation of NFKB1 protein's promoter binding site (-45 bp) impaired the ability of ITGB3BP to downregulate this protein.
12180971 Bikunin downregulates constitutive & PMA-stimulated uPAR mRNA & protein Through suppression of upstream ERK cascade targets, whether cells were treated with exogenous bikunin or transfected with bikunin gene.
12174885 circulating UPA is not up-regulated by the circulating P105 fraction of the HER-2/neu proto-oncogene: in vivo evidence from patients with advanced non-small cell lung cancer
12138365 MCP-1, MCP-2 & MCP-3 increased uPAR mRNA levels in time-dependent & dose-dependent manners. Up-regulation of uPAR in target cells might be an important and common feature of chemoattractants.
12130664 prognostic biomarker for endometrial cancer
12124797 Human breast adenocarcinoma cell lines promote angiogenesis by providing cells with uPA-PAI-1 and by enhancing their expression.
12115506 expression of uPA and uPAR is associated with the clinical behaviour of bladder neoplasms
12084931 interaction with urokinase mediates inhibitory signal for HIV-1 replication
12070711 Interferon-alpha (Intron A) upregulates urokinase-type plasminogen activator receptor gene expression
12023847 Structural analysis of the interaction between urokinase-type plasminogen activator and its receptor: a potential target for anti-invasive cancer therapy. Review.
12023845 essential role in acute inflammation as well as in chronic degenerative vascular processes such as atherosclerosis
12017319 uPA receptor is expressed in benign and malignant thyroid tumors.
11959893 Targeting urokinase-type plasminogen activator receptor on human glioblastoma tumors with diphtheria toxin fusion protein DTAT.
11928822 REVIEW: The urokinase plasminogen activator receptor in the regulation of the actin cytoskeleton and cell motility.
11928816 Coculture of monocytes and vascular smooth muscle results in increased expression of cell surface-associated uPAR in VSMC and up-regulation of UPA in monocytes, resulting in VSMC migration.
11928807 UPA receptor is weakly upregulated by bFGF in normal muscle satellite cells, while it is strongly up-regulated by TGFbeta, mainly in dystrophic myoblasts.
11928806 Amino acid substitutions at serine residues in UPA prevent signaling through UPAR, and prevents physical association of UPAR with alphavbeta5 vitronectin receptor, which is required for MCF-7 urokinase-dependent cell migration.
11903048 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor
11814408 oxidative stress in AD and microglial activation establish a possible involvement of uPAR in AD pathogenesis.
11756447 uPA-dependent VSMC adhesion is a function of selective Vn phosphorylation by the ectoprotein kinase CK2
11728456 uPA regulates uPAR expression at a post-transcriptional level, by promoting the binding of uPAR mRNA to a stabilizing factor.
10722370 HIV-1 gp120 upregulates the expression of plasminogen activator, urokinase receptor (PLAUR) in human B cells

AA Sequence

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS      1 - 70
EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP     71 - 140
EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP    141 - 210
QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM    211 - 280
NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT                   281 - 335
//

Text Mined References (471)

PMID Year Title
27078836 2016 Serum uPAR as Biomarker in Breast Cancer Recurrence: A Mathematical Model.
26846181 2016 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 2015 Expression of uPAR in human trophoblast and its role in trophoblast invasion.
26764285 2016 Copenhagen uPAR prostate cancer (CuPCa) database: protocol and early results.
26718775 2016 Hypoxia inducible factor-1 mediates upregulation of urokinase-type plasminogen activator receptor gene transcription during hypoxia in cervical cancer cells.
26697731 2015 Plasma-soluble urokinase plasminogen activator receptor (suPAR) levels in psoriasis patients and correlation with disease severity.
26577922 2015 The interaction of uPAR with VEGFR2 promotes VEGF-induced angiogenesis.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 2015 Urokinase Receptor Promotes Skin Tumor Formation by Preventing Epithelial Cell Activation of Notch1.
26504024 2015 Plasminogen Activation System in Rectal Adenocarcinoma.
26451727 2015 Increased Soluble Urokinase-Type Plasminogen Activator Receptor (suPAR) Levels in Plasma of Suicide Attempters.
26420039 2015 Urokinase-type plasminogen activator receptor interaction with ?1 integrin is required for platelet-derived growth factor-AB-induced human mesenchymal stem/stromal cell migration.
26384478 2015 Soluble urokinase-type plasminogen activator receptor as a putative marker of male accessory gland inflammation.
26380984 2015 Soluble Urokinase Receptor Levels Are Correlated with Focal Segmental Glomerulosclerosis Lesions in IgA Nephropathy: A Cohort Study from China.
26317203 2015 Progression of Osteosarcoma from a Non-Metastatic to a Metastatic Phenotype Is Causally Associated with Activation of an Autocrine and Paracrine uPA Axis.
26162494 2015 Urokinase plasminogen activator receptor and its soluble form in common biopsy-proven kidney diseases and in staging of diabetic nephropathy.
26082201 2015 Urokinase receptor and CXCR4 are regulated by common microRNAs in leukaemia cells.
26050228 2015 Macrophages of M1 phenotype have properties that influence lung cancer cell progression.
25925849 2015 PTEN expression in endothelial cells is down-regulated by uPAR to promote angiogenesis.
25837250 2015 Soluble Urokinase Receptor Is Released Selectively by Glioblastoma Cells That Express Epidermal Growth Factor Receptor Variant III and Promotes Tumor Cell Migration and Invasion.
25771228 2015 Soluble urokinase plasminogen activator receptor as a prognostic marker of all-cause and cardiovascular mortality in a black population.
25709430 2015 Soluble urokinase-type plasminogen activator receptor is a novel biomarker predicting acute exacerbation in COPD.
25704300 2015 Soluble urokinase plasminogen activator receptor--a valuable biomarker in systemic lupus erythematosus?
25695339 2015 The inflammatory marker suPAR after cardiac arrest.
25692297 2015 Epithelial and stromal cell urokinase plasminogen activator receptor expression differentially correlates with survival in rectal cancer stages B and C patients.
25664394 2015 Intact and cleaved plasma soluble urokinase receptor in patients with metastatic colorectal cancer treated with oxaliplatin with or without cetuximab.
25661888 2015 Subpopulations of uPAR+ contribute to vasculogenic mimicry and metastasis in large cell lung cancer.
25618124 Soluble urokinase-type plasminogen activator receptor and ferritin concentration in patients with advanced alimentary tract carcinoma. Relationship to localization, surgical treatment and the stage of the disease--preliminary report.
25575713 2015 Urokinase-type plasminogen activator receptor (uPAR) expression is associated with T-stage and survival in urothelial carcinoma of the bladder.
25574858 2015 Plasma soluble urokinase-type plasminogen activator receptor level is independently associated with coronary microvascular function in patients with non-obstructive coronary artery disease.
25544710 2015 Overexpression of ETV4 is associated with poor prognosis in prostate cancer: involvement of uPA/uPAR and MMPs.
25519042 2015 In vivo anti-metastatic effects of uPAR retargeted measles virus in syngeneic and xenograft models of mammary cancer.
25500737 2015 Clinical significance of serum and urinary soluble urokinase receptor (suPAR) in primary nephrotic syndrome and MPO-ANCA-associated glomerulonephritis in Japanese.
25490122 2015 Cigarette Smoke and the Induction of Urokinase Plasminogen Activator Receptor In Vivo: Selective Contribution of Isoforms to Bronchial Epithelial Phenotype.
25456503 2015 Extracellular matrix biomarker, fibulin-1 and its association with soluble uPAR in a bi-ethnic South African population: the SAfrEIC study.
25444509 2014 Polymorphisms in the fibrinolytic pathway genes and the risk of recurrent spontaneous abortion.
25329298 2014 Soluble urokinase plasminogen activator receptor as a marker for use of antidepressants.
25319791 2015 Host response biomarker in sepsis: suPAR detection.
25318615 2014 Characterization of the interaction between heterodimeric ?v?6 integrin and urokinase plasminogen activator receptor (uPAR) using functional proteomics.
25315615 2015 Soluble urokinase plasminogen activator receptor: an indicator of pneumonia severity in children.
25313007 2015 Differential uPAR recruitment in caveolar-lipid rafts by GM1 and GM3 gangliosides regulates endothelial progenitor cells angiogenesis.
25310970 2014 uPAR induces expression of transforming growth factor ? and interleukin-4 in cancer cells to promote tumor-permissive conditioning of macrophages.
25244504 2014 Urokinase-type plasminogen activator (uPA) stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2.
25236186 2014 miR-10b is overexpressed in hepatocellular carcinoma and promotes cell proliferation, migration and invasion through RhoC, uPAR and MMPs.
25222341 2014 Soluble urokinase plasminogen activator receptor is in contrast to high-sensitive C-reactive-protein associated with coronary artery calcifications in healthy middle-aged subjects.
25215932 2014 Elongation factor-2 kinase regulates TG2/?1 integrin/Src/uPAR pathway and epithelial-mesenchymal transition mediating pancreatic cancer cells invasion.
25196912 2015 Urokinase receptor mediates osteoclastogenesis via M-CSF release from osteoblasts and the c-Fms/PI3K/Akt/NF-?B pathway in osteoclasts.
25185729 2015 Circulating suPAR levels are affected by glomerular filtration rate and proteinuria in primary and secondary glomerulonephritis.
25175595 2014 Heat shock proteins HSP70 and MRJ cooperatively regulate cell adhesion and migration through urokinase receptor.
25174715 2014 Synergy of urokinase?type plasminogen activator receptor isomer (D1D2) and integrin ?5?1 causes malignant transformation of hepatic cells and the occurrence of liver cancer.
25168639 2014 The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins.
25154621 2015 Soluble urokinase-type plasminogen activator receptor levels in patients with schizophrenia.
25127435 2014 The role of serum soluble urokinase-type plasminogen activator receptor in stable chronic obstructive pulmonary disease.
25120753 2014 Co-expression of uPAR and CXCR4 promotes tumor growth and metastasis in small cell lung cancer.
25113506 2014 Urokinase-type plasminogen activator receptor regulates apoptotic sensitivity of colon cancer HCT116 cell line to TRAIL via JNK-p53 pathway.
25014213 2014 Extracellular matrix biomarker, fibulin-1, is closely related to NT-proBNP and soluble urokinase plasminogen activator receptor in patients with aortic valve stenosis (the SEAS study).
24999729 2014 Urokinase plasminogen activator receptor (uPAR) and plasminogen activator inhibitor-1 (PAI-1) are potential predictive biomarkers in early stage oral squamous cell carcinomas (OSCC).
24987841 2014 Loss of urokinase receptor sensitizes cells to DNA damage and delays DNA repair.
24889870 2014 Urokinase-type plasminogen activator receptor (uPAR) on tumor-associated macrophages is a marker of poor prognosis in colorectal cancer.
24882949 2014 Clinical value of plasma soluble urokinase-type plasminogen activator receptor levels in term neonates with infection or sepsis: a prospective study.
24877154 2014 Association of tissue mRNA and serum antigen levels of members of the urokinase-type plasminogen activator system with clinical and prognostic parameters in prostate cancer.
24807674 2014 Downregulation of galectin-3 causes a decrease in uPAR levels and inhibits the proliferation, migration and invasion of hepatocellular carcinoma cells.
24763226 2014 Urokinase-type plasminogen activator receptor signaling is critical in nasopharyngeal carcinoma cell growth and metastasis.
24742002 2014 Expression of uPAR in tumor-associated stromal cells is associated with colorectal cancer patient prognosis: a TMA study.
24731575 2014 Association between promoter region of the uPAR (rs344781) gene polymorphism in genetic susceptibility to migraine without aura in three Iranian hospitals.
24699410 2014 uPAR and cathepsin B-mediated compartmentalization of JNK regulates the migration of glioma-initiating cells.
24688027 2014 High molecular weight kininogen binds phosphatidylserine and opsonizes urokinase plasminogen activator receptor-mediated efferocytosis.
24648800 2014 Urokinase, urokinase receptor, and plasminogen activator inhibitor-1 expression on podocytes in immunoglobulin A glomerulonephritis.
24644284 2014 Urokinase-type plasminogen activator receptor (uPAR) ligation induces a raft-localized integrin signaling switch that mediates the hypermotile phenotype of fibrotic fibroblasts.
24604320 2014 Correlation between the overexpression of urokinase receptor isoform uPAR (D1D2) and hepatic cell malignant transformation.
24603291 2014 Predictive value of soluble urokinase plasminogen activator receptor, soluble ST2, and IL-33 in bronchopulmonary dysplasia.
24575897 2014 Clinical relevance and cellular source of elevated soluble urokinase plasminogen activator receptor (suPAR) in acute liver failure.
24530340 2014 Prognostic significance of circulating intact and cleaved forms of urokinase plasminogen activator receptor in inoperable chemotherapy treated cholangiocarcinoma patients.
24466048 2014 The urokinase receptor takes control of cell migration by recruiting integrins and FPR1 on the cell surface.
24457100 2014 Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration.
24325546 2013 Involvement of nitric oxide synthase in matrix metalloproteinase-9- and/or urokinase plasminogen activator receptor-mediated glioma cell migration.
24253546 2014 Soluble urokinase plasminogen activator receptor: a risk factor for carotid plaque, stroke, and coronary artery disease.
24249636 2014 Genome-wide protein QTL mapping identifies human plasma kallikrein as a post-translational regulator of serum uPAR levels.
24217605 2014 Role of uPA/uPAR in the modulation of angiogenesis.
24192237 2014 Urokinase receptor mediates osteogenic differentiation of mesenchymal stem cells and vascular calcification via the complement C5a receptor.
23939376 2013 A urokinase receptor-derived peptide inhibiting VEGF-dependent directional migration and vascular sprouting.
23923008 2013 HIV-1 infected lymphoid organs upregulate expression and release of the cleaved form of uPAR that modulates chemotaxis and virus expression.
23897640 2014 Common genetic variants in the plasminogen activation pathway are not associated with multiple sclerosis.
23874017 2013 Circulating permeability factor suPAR: from concept to discovery to clinic.
23843896 2013 Role of urokinase receptor in tumor progression and development.
23842190 2013 Podocyte effacement closely links to suPAR levels at time of posttransplantation focal segmental glomerulosclerosis occurrence and improves with therapy.
23835994 2013 Soluble receptor for urokinase plasminogen activator in community-acquired pneumonia in children.
23806081 2013 The role of uPAR in epithelial-mesenchymal transition in small airway epithelium of patients with chronic obstructive pulmonary disease.
23747086 Treatment with beta-blockers is associated with lower levels of Lp-PLA2 and suPAR in carotid plaques.
23742830 2013 The significance of serum urokinase plasminogen activation receptor (suPAR) in the diagnosis and follow-up of febrile neutropenic patients with hematologic malignancies.
23736353 2013 Urine but not serum soluble urokinase receptor (suPAR) may identify cases of recurrent FSGS in kidney transplant candidates.
23709605 2013 Domain 2 of uPAR regulates single-chain urokinase-mediated angiogenesis through ?1-integrin and VEGFR2.
23667902 2012 Overexpression of the urokinase receptor splice variant uPAR-del4/5 in breast cancer cells affects cell adhesion and invasion in a dose-dependent manner and modulates transcription of tumor-associated genes.
23565268 2013 Relationship of circulating soluble urokinase plasminogen activator receptor (suPAR) levels to disease control in asthma and asthmatic pregnancy.
23541763 2013 Deregulated expression of urokinase and its inhibitor type 1 in prostate cancer cells: role of epigenetic mechanisms.
23525268 2013 Deacetylated GM3 promotes uPAR-associated membrane molecular complex to activate p38 MAPK in metastatic melanoma.
23516493 2013 NT-proBNP, C-reactive protein and soluble uPAR in a bi-ethnic male population: the SAfrEIC study.
23512428 2013 Diagnostic and prognostic significance of CA IX and suPAR in gastric cancer.
23486467 2013 The soluble form of LR11 protein is a regulator of hypoxia-induced, urokinase-type plasminogen activator receptor (uPAR)-mediated adhesion of immature hematological cells.
23447064 2013 Plasma soluble urokinase receptor levels are increased but do not distinguish primary from secondary focal segmental glomerulosclerosis.
23408042 2013 Urokinase receptor orchestrates the plasminogen system in airway epithelial cell function.
23400595 2013 Targeting uPAR with antagonistic recombinant human antibodies in aggressive breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23327926 2013 Direct evidence of the importance of vitronectin and its interaction with the urokinase receptor in tumor growth.
23238745 2013 uPAR regulates pericellular proteolysis through a mechanism involving integrins and fMLF-receptors.
23222817 2013 Cathepsin B and uPAR regulate self-renewal of glioma-initiating cells through GLI-regulated Sox2 and Bmi1 expression.
23222509 2012 uPAR and cathepsin B shRNA impedes TGF-?1-driven proliferation and invasion of meningioma cells in a XIAP-dependent pathway.
23180655 2013 Genetic variants in the vitamin D pathway and breast cancer disease-free survival.
23172421 2013 Urokinase receptor mediates doxorubicin-induced vascular smooth muscle cell senescence via proteasomal degradation of TRF2.
23150653 2012 Soluble urokinase plasminogen activator receptor is associated with inflammation in the vulnerable human atherosclerotic plaque.
23138488 2012 Circulating suPAR in two cohorts of primary FSGS.
23136192 2013 The critical role of dysregulated FOXM1-PLAUR signaling in human colon cancer progression and metastasis.
23117033 2013 Significantly increased concentration of soluble urokinase-type plasminogen activator receptor in the blood of patients with pelvic inflammatory disease.
23076139 MMP-9 and uPAR regulated glioma cell migration.
23049759 2012 Single amino acid substitutions in the chemotactic sequence of urokinase receptor modulate cell migration and invasion.
23033975 2012 Plasma soluble urokinase plasminogen activator receptor (suPAR) levels in systemic lupus erythematosus.
23030781 2013 The liberated domain I of urokinase plasminogen activator receptor--a new tumour marker in small cell lung cancer.
22984561 2012 Apoptosis induced by knockdown of uPAR and MMP-9 is mediated by inactivation of EGFR/STAT3 signaling in medulloblastoma.
22909410 2013 Cardiovascular risk prediction in the general population with use of suPAR, CRP, and Framingham Risk Score.
22906080 2012 Aggregated low-density lipoprotein induce impairment of the cytoskeleton dynamics through urokinase-type plasminogen activator/urokinase-type plasminogen activator receptor in human vascular smooth muscle cell.
22896701 2012 A flexible multidomain structure drives the function of the urokinase-type plasminogen activator receptor (uPAR).
22782499 2012 The urokinase receptor (CD87) represents a central mediator of growth factor-induced endothelial cell migration.
22732587 2012 Cutting edge: Clec9A+ dendritic cells mediate the development of experimental cerebral malaria.
22702340 2012 In papillary thyroid carcinoma BRAFV600E is associated with increased expression of the urokinase plasminogen activator and its cognate receptor, but not with disease-free interval.
22633212 2012 Soluble urokinase plasminogen activator receptor in patients with abdominal aortic aneurysm.
22577342 2012 Differential roles of uPAR in peritoneal ovarian carcinomatosis.
22487523 Invasive markers identified by gene expression profiling in pancreatic cancer.
22470492 2012 Degradation of internalized ?v?5 integrin is controlled by uPAR bound uPA: effect on ?1 integrin activity and ?-SMA stress fiber assembly.
22467324 2012 Expression of urokinase-type plasminogen activator (uPA), its receptor (uPAR), and inhibitor (PAI-1) in human breast carcinomas and their clinical relevance.
22459389 2013 CRP and suPAR are differently related to anthropometry and subclinical organ damage.
22366462 2012 RhoB regulates uPAR signalling.
22363796 2012 Urokinase plasminogen receptor and the fibrinolytic complex play a role in nerve repair after nerve crush in mice, and in human neuropathies.
22298164 2012 Simvastatin and atorvastatin attenuate VCAM-1 and uPAR expression on human endothelial cells and platelet surface expression of CD40 ligand.
22287577 2012 VEGF-induced endothelial cell migration requires urokinase receptor (uPAR)-dependent integrin redistribution.
22285761 2012 Crystal structure of the urokinase receptor in a ligand-free form.
22199285 2011 Resveratrol reduces TNF-?-induced U373MG human glioma cell invasion through regulating NF-?B activation and uPA/uPAR expression.
22177802 2012 uPA and uPAR shRNA inhibit angiogenesis via enhanced secretion of SVEGFR1 independent of GM-CSF but dependent on TIMP-1 in endothelial and glioblastoma cells.
22139533 2012 uPAR regulates bronchial epithelial repair in vitro and is elevated in asthmatic epithelium.
22119508 2012 Soluble urokinase plasminogen activator receptor in plasma is associated with incidence of CVD. Results from the Malmö Diet and Cancer Study.
22113150 2012 Exploring soluble urokinase plasminogen activator receptor and its relationship with arterial stiffness in a bi-ethnic population: the SAfrEIC-study.
22098627 2012 Circulating soluble urokinase plasminogen activator is elevated in patients with chronic liver disease, discriminates stage and aetiology of cirrhosis and predicts prognosis.
22075245 2012 Urokinase receptor associates with myocardin to control vascular smooth muscle cells phenotype in vascular disease.
22025616 2011 Mimicry of the regulatory role of urokinase in lamellipodia formation by introduction of a non-native interdomain disulfide bond in its receptor.
22004682 2011 Specific knockdown of uPA/uPAR attenuates invasion in glioblastoma cells and xenografts by inhibition of cleavage and trafficking of Notch -1 receptor.
21945852 2011 Chk2-mediated G2/M cell cycle arrest maintains radiation resistance in malignant meningioma cells.
21934527 2012 Soluble urokinase plasminogen activator receptor is associated with progressive liver fibrosis in hepatitis C infection.
21896743 2011 Crosstalk between the urokinase-type plasminogen activator receptor and EGF receptor variant III supports survival and growth of glioblastoma cells.
21848504 2011 mRNA expression levels of the biological factors uPAR, uPAR-del4/5, and rab31, displaying prognostic value in breast cancer, are not clinically relevant in advanced ovarian cancer.
21840777 2011 Mechanism of p27 upregulation induced by downregulation of cathepsin B and uPAR in glioma.
21833477 2011 Expression of urokinase-type plasminogen activator/urokinase-type plasminogen activator receptor and maspin in oral squamous cell carcinoma: Association with mode of invasion and clinicopathological factors.
21804539 2011 Circulating urokinase receptor as a cause of focal segmental glomerulosclerosis.
21803847 2011 Endothelial progenitor cell-dependent angiogenesis requires localization of the full-length form of uPAR in caveolae.
21799009 2011 Conformational regulation of urokinase receptor function: impact of receptor occupancy and epitope-mapped monoclonal antibodies on lamellipodia induction.
21761413 2011 Genetic polymorphism of the plasminogen activator inhibitor-1 is associated with an increased risk of endometrial cancer.
21744990 2011 Clinical significance of the plasminogen activator system in relation to grade of tumor and treatment response in colorectal carcinoma patients.
21711960 The expression of fibrinolytic components in chronic paranasal sinus disease.
21702998 2011 Combined mRNA expression levels of members of the urokinase plasminogen activator (uPA) system correlate with disease-associated survival of soft-tissue sarcoma patients.
21638078 2012 Role of urokinase plasminogen activator receptor (CD87) as a prognostic marker in acute myeloid leukemia.
21630091 2011 Urinary-type plasminogen activator receptor (uPAR) modulates oral cancer cell behavior with alteration in p130cas.
21602447 2011 Number and brightness image analysis reveals ATF-induced dimerization kinetics of uPAR in the cell membrane.
21544310 2011 Interaction of high-molecular-weight kininogen with endothelial cell binding proteins suPAR, gC1qR and cytokeratin 1 determined by surface plasmon resonance (BiaCore).
21478092 2010 Concentrations of plasminogen activator inhibitor-1 (PAI-1) and urokinase plasminogen activator (uPA) in induced sputum of asthma patients after allergen challenge.
21470685 2011 Participation of the urokinase-type plasminogen activator receptor (uPAR) in neutrophil transendothelial migration.
21470667 2011 Urokinase plasminogen activator receptor levels in Behcet's disease.
21456072 2011 Prognostic and predictive value of intact and cleaved forms of the urokinase plasminogen activator receptor in metastatic prostate cancer.
21426933 2011 Suppression of uPA and uPAR blocks radiation-induced MCP-1 mediated recruitment of endothelial cells in meningioma.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21419107 2011 MicroRNA-10b induces glioma cell invasion by modulating MMP-14 and uPAR expression via HOXD10.
21391216 2012 Profiling signalling pathways in formalin-fixed and paraffin-embedded breast cancer tissues reveals cross-talk between EGFR, HER2, HER3 and uPAR.
21354571 2011 Soluble urokinase plasminogen activator receptor is associated with subclinical organ damage and cardiovascular events.
21304107 2011 Density enhanced phosphatase-1 down-regulates urokinase receptor surface expression in confluent endothelial cells.
21224999 2011 Overexpression of urokinase-type plasminogen activator in pterygia and pterygium fibroblasts.
21191179 2011 Downregulation of uPAR inhibits migration, invasion, proliferation, FAK/PI3K/Akt signaling and induces senescence in papillary thyroid carcinoma cells.
21181094 2011 Downregulation of uPA/uPAR inhibits intermittent hypoxia-induced epithelial-mesenchymal transition (EMT) in DAOY and D283 medulloblastoma cells.
21148633 2011 siRNA-mediated downregulation of MMP-9 and uPAR in combination with radiation induces G2/M cell-cycle arrest in Medulloblastoma.
21106716 2011 High expression of the urokinase plasminogen activator and its cognate receptor associates with advanced stages and reduced disease-free interval in papillary thyroid carcinoma.
21106094 2010 Localization of uPAR and MMP-9 in lipid rafts is critical for migration, invasion and angiogenesis in human breast cancer cells.
21088115 2011 Urokinase receptor mediates mobilization, migration, and differentiation of mesenchymal stem cells.
21081472 2011 MSP-induced RON activation upregulates uPAR expression and cell invasiveness via MAPK, AP-1 and NF-?B signals in gastric cancer cells.
21060833 2010 Downregulation of uPAR and cathepsin B induces apoptosis via regulation of Bcl-2 and Bax and inhibition of the PI3K/Akt pathway in gliomas.
20972812 2011 The cross-talk between the urokinase receptor and fMLP receptors regulates the activity of the CXCR4 chemokine receptor.
20967855 2011 A genetic variation located in the promoter region of the UPAR (CD87) gene is associated with the vascular complications of systemic sclerosis.
20937265 2011 Association of polymorphisms in the genes of the urokinase plasminogen activation system with susceptibility to and severity of non-small cell lung cancer.
20886176 2010 Urokinase-type plasminogen activator receptor is associated with the development of adipose tissue.
20858596 2010 Molecular networks implicated in speech-related disorders: FOXP2 regulates the SRPX2/uPAR complex.
20840675 2010 Prognostic relevance of tumour cell-associated uPAR expression in invasive ductal breast carcinoma.
20805979 2010 Suppression of uPA and uPAR attenuates angiogenin mediated angiogenesis in endothelial and glioblastoma cell lines.
20696135 2010 Novel protein interactors of urokinase-type plasminogen activator receptor.
20693875 2010 In vivo fluorescence-mediated tomography for quantification of urokinase receptor-dependent leukocyte trafficking in inflammation.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20661471 2010 Co-depletion of cathepsin B and uPAR induces G0/G1 arrest in glioma via FOXO3a mediated p27 upregulation.
20648659 2010 Increased expression of urokinase-type plasminogen activator receptor in the frontal cortex of patients with intractable frontal lobe epilepsy.
20635136 2011 Overexpression of the urokinase receptor mRNA splice variant uPAR-del4/5 affects tumor-associated processes of breast cancer cells in vitro and in vivo.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624254 2010 Urokinase-type plasminogen activator system and human cationic antimicrobial protein 18 in serum and induced sputum of patients with chronic obstructive pulmonary disease.
20580686 2010 Urokinase receptor (uPAR) regulates complement receptor 3 (CR3)-mediated neutrophil phagocytosis.
20558828 2010 Role of the urokinase plasminogen activator receptor in mediating impaired efferocytosis of anti-SSA/Ro-bound apoptotic cardiocytes: Implications in the pathogenesis of congenital heart block.
20518747 2010 Association of putative functional variants in the PLAU gene and the PLAUR gene with myocardial infarction.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20447686 2010 Genetic polymorphisms in the fibrinolytic system of placentas with massive perivillous fibrin deposition.
20403162 2010 Increased expression of urokinase plasminogen activator and its cognate receptor in human seminomas.
20372789 2010 Interaction between urokinase receptor and heat shock protein MRJ enhances cell adhesion.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20198323 2010 Radiation-inducible silencing of uPA and uPAR in vitro and in vivo in meningioma.
20145038 2010 Urinary-type plasminogen activator receptor/alpha 3 beta 1 integrin signaling, altered gene expression, and oral tumor progression.
20142364 2010 Urokinase receptor is necessary for bacterial defense against pneumonia-derived septic melioidosis by facilitating phagocytosis.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20063318 2010 RNAi-mediated downregulation of uPAR synergizes with targeting of HER2 through the ERK pathway in breast cancer cells.
20051950 2010 Co-detection of members of the urokinase plasminogen activator system in tumour tissue and serum correlates with a poor prognosis for soft-tissue sarcoma patients.
20012874 2010 Relationship between urokinase plasminogen activator receptor (uPAR) and the invasion of human prenatal hair follicle.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19908229 2010 Spred2 inhibits TGF-beta1-induced urokinase type plasminogen activator expression, cell motility and epithelial mesenchymal transition.
19878584 2009 PLAUR polymorphisms and lung function in UK smokers.
19796867 2010 ECRG2 regulates ECM degradation and uPAR/FPRL1 pathway contributing cell invasion/migration.
19782465 2010 Lithocholic acid upregulates uPAR and cell invasiveness via MAPK and AP-1 signaling in colon cancer cells.
19756998 2010 Release of the soluble urokinase-type plasminogen activator receptor (suPAR) by activated neutrophils in rheumatoid arthritis.
19740518 2010 Urokinase-type plasminogen activator is a marker of aggressive phenotype and an independent prognostic factor in mismatch repair-proficient colorectal cancer.
19717562 2009 ECRG2 regulates cell migration/invasion through urokinase-type plasmin activator receptor (uPAR)/beta1 integrin pathway.
19693769 2009 Down-regulation of uPA and uPAR by 3,3'-diindolylmethane contributes to the inhibition of cell growth and migration of breast cancer cells.
19691446 2009 Urokinase-receptor-mediated phenotypic changes in vascular smooth muscle cells require the involvement of membrane rafts.
19642359 2009 [Clinical study on the fibrinolytic activity in patients with acute promyelocytic leukemia].
19638192 2009 Characterisation of urokinase plasminogen activator receptor variants in human airway and peripheral cells.
19635932 2010 The urokinase receptor supports tumorigenesis of human malignant pleural mesothelioma cells.
19616049 2009 Soluble urokinase receptor conjugated to carrier red blood cells binds latent pro-urokinase and alters its functional profile.
19609941 2010 Urokinase plasminogen activator receptor is expressed in invasive cells in gastric carcinomas from high- and low-risk countries.
19546228 2009 Reversibility of epithelial-mesenchymal transition (EMT) induced in breast cancer cells by activation of urokinase receptor-dependent cell signaling.
19497996 2009 The urokinase receptor promotes cancer metastasis independently of urokinase-type plasminogen activator in mice.
19480010 2009 Urokinase receptor, MMP-1 and MMP-9 are markers to differentiate prognosis, adenoma and carcinoma in thyroid malignancies.
19475533 2009 Tumor stroma is the predominant uPA-, uPAR-, PAI-1-expressing tissue in human breast cancer: prognostic impact.
19472211 2009 Plasminogen activator inhibitors regulate cell adhesion through a uPAR-dependent mechanism.
19461880 2009 The urokinase receptor (uPAR) facilitates clearance of Borrelia burgdorferi.
19443353 2009 Urokinase-type plasminogen activator and plasminogen-activator-inhibitor type 1 predict metastases in good prognosis breast cancer patients.
19443020 2009 PLAUR polymorphisms are associated with asthma, PLAUR levels, and lung function decline.
19436306 2009 Bacterial endotoxin enhances colorectal cancer cell adhesion and invasion through TLR-4 and NF-kappaB-dependent activation of the urokinase plasminogen activator system.
19435784 2009 Amplification of the urokinase-type plasminogen activator receptor (uPAR) gene in ductal pancreatic carcinomas identifies a clinically high-risk group.
19433314 Suppression of urokinase plasminogen activator receptor inhibits proliferation and migration of pancreatic adenocarcinoma cells via regulation of ERK/p38 signaling.
19411312 2009 Urokinase receptor mediates lung fibroblast attachment and migration toward provisional matrix proteins through interaction with multiple integrins.
19404710 2009 Preoperative u-PAR gene expression in bone marrow indicates the potential power of recurrence in breast cancer cases.
19403319 2009 Ab initio molecular orbital calculations on specific interactions between urokinase-type plasminogen activator and its receptor.
19383607 2009 The urokinase plasminogen activator receptor promotes efferocytosis of apoptotic cells.
19298527 2009 Survivin is an essential mediator of arthritis interacting with urokinase signalling.
19177204 2009 Transcriptional regulation of urokinase-type plasminogen activator receptor by hypoxia-inducible factor 1 is crucial for invasion of pancreatic and liver cancer.
19176991 2008 The plasminogen activator system and cancer.
19157142 2008 [The expression and significance of urokinase-type plasminogen activator and its receptor in squamous cell carcinoma of hypopharynx].
19123477 2009 Two distinct expression patterns of urokinase, urokinase receptor and plasminogen activator inhibitor-1 in colon cancer liver metastases.
19117638 2009 Plasminogen activator inhibitor variants PAI-1 A15T and PAI-2 S413C influence lung cancer prognosis.
19115132 2009 Expression of the urokinase plasminogen activator receptor (uPAR) and its ligand (uPA) in brain tissues of human immunodeficiency virus patients with opportunistic cerebral diseases.
19088796 2008 Effect of oxidative stress on the expression of t-PA, u-PA, u-PAR, and PAI-1 in endothelial cells.
19050704 2009 Expression of uPAR mRNA in peripheral blood is a favourite marker for metastasis in gastric cancer cases.
19037107 2009 Mannose 6-phosphate/insulin-like growth factor 2 receptor limits cell invasion by controlling alphaVbeta3 integrin expression and proteolytic processing of urokinase-type plasminogen activator receptor.
19020743 2008 EGF stimulates uPAR expression and cell invasiveness through ERK, AP-1, and NF-kappaB signaling in human gastric carcinoma cells.
19017363 2009 A suppressor of multiple extracellular matrix-degrading proteases and cancer metastasis.
19008962 2008 Clathrin and LRP-1-independent constitutive endocytosis and recycling of uPAR.
18957516 2008 A dual role for caveolin-1 in the regulation of fibronectin matrix assembly by uPAR.
18954937 2008 Increased soluble urokinase plasminogen activator receptor (suPAR) is associated with thrombosis and inhibition of plasmin generation in paroxysmal nocturnal hemoglobinuria (PNH) patients.
18953252 2008 Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding.
18949356 2008 uPA/uPAR downregulation inhibits radiation-induced migration, invasion and angiogenesis in IOMM-Lee meningioma cells and decreases tumor growth in vivo.
18941116 2009 Ligand-engaged urokinase-type plasminogen activator receptor and activation of the CD11b/CD18 integrin inhibit late events of HIV expression in monocytic cells.
18940913 2008 Signaling through urokinase and urokinase receptor in lung cancer cells requires interactions with beta1 integrins.
18830568 2009 Activated human neutrophils rapidly release the chemotactically active D2D3 form of the urokinase-type plasminogen activator receptor (uPAR/CD87).
18819934 2008 Sphingosine-1-phosphate and interleukin-1 independently regulate plasminogen activator inhibitor-1 and urokinase-type plasminogen activator receptor expression in glioblastoma cells: implications for invasiveness.
18813852 2008 Urokinase-type plasminogen activator receptor is associated with macrophages and plaque rupture in symptomatic carotid atherosclerosis.
18813792 2008 Simultaneous downregulation of uPAR and MMP-9 induces overexpression of the FADD-associated protein RIP and activates caspase 9-mediated apoptosis in gliomas.
18808175 2008 Differential proteome expression associated with urokinase plasminogen activator receptor (uPAR) suppression in malignant epithelial cancer.
18788551 2008 [Expression of urokinase-type plasminogen activator and urokinase-type plasminogen activator receptor in synovial fluid of patients with temporomandibular disorders].
18762175 2008 Fatty acids differentially modify the expression of urokinase type plasminogen activator receptor in monocytes.
18725541 2008 uPAR promotes formation of the p130Cas-Crk complex to activate Rac through DOCK180.
18718938 2008 Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
18691743 2009 Evaluation of plasma urokinase-type plasminogen activator and urokinase-type plasminogen-activator receptor in patients with acute and chronic hepatitis B.
18673553 2008 Prognostic value analysis of urokinase-type plasminogen activator receptor in oral squamous cell carcinoma: an immunohistochemical study.
18644795 2008 Urokinase-type plasminogen activator receptor induces conformational changes in the integrin alphaMbeta2 headpiece and reorientation of its transmembrane domains.
18599586 2008 Increased expression of the urokinase plasminogen activator system by Helicobacter pylori in gastric epithelial cells.
18511987 2008 Antigen levels of urokinase-type plasminogen activator receptor and its gene polymorphism related to microvessel density in colorectal cancer.
18508599 2008 Urokinase and its receptors in chronic kidney disease.
18508598 2008 Structure and ligand interactions of the urokinase receptor (uPAR).
18487955 2008 uPAR mediates anticancer activity of PEDF.
18376415 2008 Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes.
18362146 2008 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18328568 2008 suPAR associates to glucose metabolic aberration during glucose stimulation in HIV-infected patients on HAART.
18315930 2008 [Plasma suPAR level in patients with multiple myeloma].
18257282 2007 [The analysis of plasma Urokinase-type plasminogen activator and Urokinase-type plasminogen activator receptor which unknown factor nosebleed patients].
18247343 2008 Lysophosphatidic acid promotes cell invasion by up-regulating the urokinase-type plasminogen activator receptor in human gastric cancer cells.
18097558 2008 suPAR, a soluble form of urokinase plasminogen activator receptor, inhibits human prostate cancer cell growth and invasion.
18095109 2005 Expression of the constitutively activated RelA/NF-kappaB in human astrocytic tumors and the in vitro implication in the regulation of urokinase-type plasminogen activator, migration, and invasion.
18084301 2008 Modification of kidney barrier function by the urokinase receptor.
18056417 2007 Monomer dimer dynamics and distribution of GPI-anchored uPAR are determined by cell surface protein assemblies.
18048089 2008 The urokinase-type plasminogen activator/its soluble receptor system is independently related to carotid atherosclerosis and associated with CC-chemokines in uraemic patients.
18029284 2008 Plasminogen activator and plasma activator inhibitor-1 in young women with polycystic ovary syndrome.
18021410 2007 The prognostic value of the suPARnostic ELISA in HIV-1 infected individuals is not affected by uPAR promoter polymorphisms.
17963689 2008 uPA binding increases UPAR localization to lipid rafts and modifies the receptor microdomain composition.
17952591 2008 Urokinase receptor splice variant uPAR-del4/5-associated gene expression in breast cancer: identification of rab31 as an independent prognostic factor.
17880283 2007 Urinary-type plasminogen activator (uPA) and its receptor (uPAR) in squamous cell carcinoma of the oral cavity.
17706320 2007 Tumour cell expression of C4.4A, a structural homologue of the urokinase receptor, correlates with poor prognosis in non-small cell lung cancer.
17664334 2007 uPAR induces epithelial-mesenchymal transition in hypoxic breast cancer cells.
17549401 2007 Down-regulation of uPAR and uPA activates caspase-mediated apoptosis and inhibits the PI3K/AKT pathway.
17548516 2007 uPAR-induced cell adhesion and migration: vitronectin provides the key.
17548471 2007 Regulation of urokinase receptor expression by p53: novel role in stabilization of uPAR mRNA.
17523079 2007 Altered expression of urokinase-type plasminogen activator and plasminogen activator inhibitor in high-risk soft tissue sarcomas.
17517866 2007 The Pseudomonas aeruginosa LasB metalloproteinase regulates the human urokinase-type plasminogen activator receptor through domain-specific endoproteolysis.
17510314 2007 Src induces urokinase receptor gene expression and invasion/intravasation via activator protein-1/p-c-Jun in colorectal cancer.
17507651 2007 Urokinase receptor cleavage: a crucial step in fibroblast-to-myofibroblast differentiation.
17487556 2007 Calcitonin receptor-stimulated migration of prostate cancer cells is mediated by urokinase receptor-integrin signaling.
17427199 2007 MEK/ERK-dependent uPAR expression is required for motility via phosphorylation of P70S6K in human hepatocarcinoma cells.
17344041 2007 The uPA receptor and the somatomedin B region of vitronectin direct the localization of uPA to focal adhesions in microvessel endothelial cells.
17330942 2007 Proteomic identification of lynchpin urokinase plasminogen activator receptor protein interactions associated with epithelial cancer malignancy.
17327908 2007 Identification of uPAR-positive chemoresistant cells in small cell lung cancer.
17319000 2007 The prognostic value of the topographic distribution of uPAR expression in invasive breast carcinomas.
17297470 2007 Tumor suppressor Pdcd4 inhibits invasion/intravasation and regulates urokinase receptor (u-PAR) gene expression via Sp-transcription factors.
17264329 2007 Association of the circulating levels of the urokinase system of plasminogen activation with the presence of prostate cancer and invasion, progression, and metastasis.
17237151 2007 The human airway trypsin-like protease modulates the urokinase receptor (uPAR, CD87) structure and functions.
17145753 2007 Urokinase receptors are required for alpha 5 beta 1 integrin-mediated signaling in tumor cells.
17101149 2007 An anti-urokinase plasminogen activator receptor (uPAR) antibody: crystal structure and binding epitope.
17079488 2006 uPAR and HER-2 gene status in individual breast cancer cells from blood and tissues.
17028265 2007 Regulation of urokinase receptor expression by protein tyrosine phosphatases.
17001307 2007 Identification of an histone H3 acetylated/K4-methylated-bound intragenic enhancer regulatory for urokinase receptor expression.
16949925 2006 Evaluation of urokinase plasminogen activator and its receptor in different grades of human prostate cancer.
16912170 2006 Plasticity in urokinase-type plasminogen activator receptor (uPAR) display in colon cancer yields metastable subpopulations oscillating in cell surface uPAR density--implications in tumor progression.
16905120 2006 Down-regulation of integrin alpha M beta 2 ligand-binding function by the urokinase-type plasminogen activator receptor.
16893520 2006 Aspirin upregulates expression of urokinase type plasminogen activator receptor (uPAR) gene in human colon cancer cells through AP1.
16858643 2005 Circulating levels of urokinase-type plasminogen activator (uPA) and its soluble receptor (suPAR) in patients with atopic eczema/dermatitis syndrome.
16756681 2006 The superoxide scavenger TEMPOL induces urokinase receptor (uPAR) expression in human prostate cancer cells.
16685436 2006 RNAi-mediated downregulation of urokinase plasminogen activator and its receptor in human meningioma cells inhibits tumor invasion and growth.
16632475 2006 Urokinase signaling through its receptor protects against anoikis by increasing BCL-xL expression levels.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16601839 2006 High urokinase expression contributes to the angiogenic properties of endothelial cells derived from circulating progenitors.
16564525 2006 Stimulation of human breast carcinoma cell invasiveness and urokinase plasminogen activator activity by glucose deprivation.
16525631 2006 siRNA-mediated simultaneous downregulation of uPA and its receptor inhibits angiogenesis and invasiveness triggering apoptosis in breast cancer cells.
16516155 2006 A novel spermatogenesis-specific uPAR gene expressed in human and mouse testis.
16510444 2006 Functional relevance of urinary-type plasminogen activator receptor-alpha3beta1 integrin association in proteinase regulatory pathways.
16504015 2006 Interleukin-1alpha enhances the aggressive behavior of pancreatic cancer cells by regulating the alpha6beta1-integrin and urokinase plasminogen activator receptor expression.
16497155 2006 Interplay of human tissue kallikrein 4 (hK4) with the plasminogen activation system: hK4 regulates the structure and functions of the urokinase-type plasminogen activator receptor (uPAR).
16467878 2006 uPAR expression under hypoxic conditions depends on iNOS modulated ERK phosphorylation in the MDA-MB-231 breast carcinoma cell line.
16456079 2006 Structure of human urokinase plasminogen activator in complex with its receptor.
16395714 2006 Expression of plasminogen activator inhibitor-1, urokinase receptor and laminin gamma-2 chain is an early coordinated event in incipient oral squamous cell carcinoma.
16267271 2006 An uncleavable uPAR mutant allows dissection of signaling pathways in uPA-dependent cell migration.
16216813 Productive infection of HUVEC by HHV-8 is associated with changes compatible with angiogenic transformations.
16127174 2005 RNA interference-directed knockdown of urokinase plasminogen activator and urokinase plasminogen activator receptor inhibits prostate cancer cell invasion, survival, and tumorigenicity in vivo.
16077991 2005 Differential gene expression of urokinase-type plasminogen activator and its receptor in human renal cell carcinoma.
16010978 2005 Regulation of urokinase receptor mRNA stability by hnRNP C in lung epithelial cells.
15951330 2005 Regulation of urokinase receptor expression by phosphoglycerate kinase is independent of its catalytic activity.
15922359 2005 Group A streptococcal surface GAPDH, SDH, recognizes uPAR/CD87 as its receptor on the human pharyngeal cell and mediates bacterial adherence to host cells.
15894933 2005 Expression of urokinase-type plasminogen activator receptor (uPAR) in primary central nervous system neoplasms.
15885322 2005 Evaluation of cerebrospinal fluid uPA, PAI-1, and soluble uPAR levels in HIV-infected patients.
15866865 2005 Cross-talk between fMLP and vitronectin receptors triggered by urokinase receptor-derived SRSRY peptide.
15863511 2005 Domain 2 of the urokinase receptor contains an integrin-interacting epitope with intrinsic signaling activity: generation of a new integrin inhibitor.
15861141 2005 Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide.
15851910 2005 High plasma levels of intact and cleaved soluble urokinase receptor reflect immune activation and are independent predictors of mortality in HIV-1-infected patients.
15849776 2005 High expression of urokinase plasminogen activator receptor (UPA-R) in acute myeloid leukemia (AML) is associated with worse prognosis.
15841307 2005 The urokinase receptor and the regulation of cell proliferation.
15831288 2005 Basal release of urokinase plasminogen activator, plasminogen activator inhibitor-1, and soluble plasminogen activator receptor from separated and cultured endometriotic and endometrial stromal and epithelial cells.
15824107 2005 Specific interference of urokinase-type plasminogen activator receptor and matrix metalloproteinase-9 gene expression induced by double-stranded RNA results in decreased invasion, tumor growth, and angiogenesis in gliomas.
15728176 2005 Dynamic assembly of the urokinase-type plasminogen activator signaling receptor complex determines the mitogenic activity of urokinase-type plasminogen activator.
15711734 2005 The urokinase plasminogen activator and its receptor: role in cell growth and apoptosis.
15684035 2005 Regulation of alpha5beta1 integrin conformation and function by urokinase receptor binding.
15677461 2005 Regulation of urokinase receptor proteolytic function by the tetraspanin CD82.
15573379 2005 Urokinase plasminogen activator receptor promotes macrophage infiltration into the vascular wall of ApoE deficient mice.
15543615 2005 Real-time quantitative PCR determination of urokinase-type plasminogen activator receptor (uPAR) expression of isolated micrometastatic cells from bone marrow of breast cancer patients.
15521066 2005 Expression of the urokinase receptor regulates focal adhesion assembly and cell migration in adenoid cystic carcinoma cells.
15515049 2005 Expression of urokinase plasminogen activator, its receptor and type-1 inhibitor in malignant and benign prostate tissue.
15494526 2004 Urokinase induces basophil chemotaxis through a urokinase receptor epitope that is an endogenous ligand for formyl peptide receptor-like 1 and -like 2.
15494432 2005 Involvement of the urokinase-type plasminogen activator receptor in hematopoietic stem cell mobilization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381392 2004 Reduced beta3-endonexin levels are associated with enhanced urokinase-type plasminogen activator receptor expression in ApoE-/- mice.
15375521 2004 In situ gene expression of urokinase-type plasminogen activator and its receptor in transitional cell carcinoma of the human bladder.
15358545 2004 Plasmin cleaves the juxtamembrane domain and releases truncated species of the urokinase receptor (CD87) from human bronchial epithelial cells.
15326109 2004 Urokinase anchors uPAR to the actin cytoskeleton.
15302576 2004 DU145 human prostate carcinoma invasiveness is modulated by urokinase receptor (uPAR) downstream of epidermal growth factor receptor (EGFR) signaling.
15285727 2004 Soluble urokinase plasminogen activator receptor in blood transfusion components.
15248186 Variability in the expression of urokinase receptor (CD87) mutants on cells: relevance to cell adhesion.
15243126 2004 Differential localization and expression of urokinase plasminogen activator (uPA), its receptor (uPAR), and its inhibitor (PAI-1) mRNA and protein in endometrial tissue during the menstrual cycle.
15188055 2004 Transcriptional regulation of urokinase receptor in high- (95D) and low-metastatic (95C) human lung cancer cells.
15182581 2004 [Study of the effect of TF/FVIIa complex on the expression of u-PAR mRNA in human ovarian cancer].
15122709 2004 The urokinase receptor is overexpressed in the AIDS dementia complex and other neurological manifestations.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15044324 2004 Urokinase-type plasminogen activator receptor is involved in mediating the apoptotic effect of cleaved high molecular weight kininogen in human endothelial cells.
15042374 2004 Pericellular proteolysis by leukocytes and tumor cells on substrates: focal activation and the role of urokinase-type plasminogen activator.
15032076 2004 Immunohistochemical evaluation of urokinase plasminogen activator receptor in noninvasive and early invasive urothelial papillary neoplasia.
15031672 2004 Involvement of MAPK pathway in hypoxia-induced up-regulation of urokinase plasminogen activator receptor in a human prostatic cancer cell line, PC3MLN4.
15031282 2004 The Kruppel-like KLF4 transcription factor, a novel regulator of urokinase receptor expression, drives synthesis of this binding site in colonic crypt luminal surface epithelial cells.
14995994 2004 Expression of receptors for plasminogen activators on endothelial cell surface depends on their origin.
14961171 2004 Metabolism of tumour-derived urokinase receptor and receptor fragments in cancer patients and xenografted mice.
14764580 2004 Mapping the interaction between high molecular mass kininogen and the urokinase plasminogen activator receptor.
14764453 2004 LR11, an LDL receptor gene family member, is a novel regulator of smooth muscle cell migration.
14764427 2004 Regulation of urokinase receptor expression by phosphoglycerate kinase.
14729600 2004 Increased metastatic dissemination in human melanoma xenografts after subcurative radiation treatment: radiation-induced increase in fraction of hypoxic cells and hypoxia-induced up-regulation of urokinase-type plasminogen activator receptor.
14702177 2004 Interleukin-1beta-induced expression of the urokinase-type plasminogen activator receptor and its co-localization with MMPs in human articular chondrocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688365 2004 Proteolytic regulation of the urokinase receptor/CD87 on monocytic cells by neutrophil elastase and cathepsin G.
14668033 2003 Urokinase plasminogen activator receptor and soluble matrix metalloproteinase-9 in acute myeloid leukemia patients: a possible relation to disease invasion.
14660675 2004 bcl-2 induction of urokinase plasminogen activator receptor expression in human cancer cells through Sp1 activation: involvement of ERK1/ERK2 activity.
14602715 2004 The receptor for urokinase-type plasminogen activator regulates fibronectin matrix assembly in human skin fibroblasts.
14601049 2003 Comparative evaluation of urokinase-type plasminogen activator receptor expression in primary breast carcinomas and on metastatic tumor cells.
14563447 2003 Detection of urokinase plasminogen activator receptor and c-erbB-2 in sera of patients with breast and ovarian carcinoma.
14531820 2003 Expression of urokinase plasminogen activator and its receptor during acute renal allograft rejection.
14520707 2003 High tumor tissue concentration of urokinase plasminogen activator receptor is associated with good prognosis in patients with ovarian cancer.
14517339 2003 Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins.
14517288 2003 Stabilization of urokinase and urokinase receptor mRNAs by HuR is linked to its cytoplasmic accumulation induced by activated mitogen-activated protein kinase-activated protein kinase 2.
14507113 2003 Pretreatment determination of the serum urokinase plasminogen activator and its soluble receptor in advanced small-cell lung cancer or non-small-cell lung cancer.
14500474 2003 The urokinase receptor can be induced by Borrelia burgdorferi through receptors of the innate immune system.
12960238 2003 The role of urokinase-type plasminogen activator (uPA)/uPA receptor in HIV-1 infection.
12952933 2003 GPI-anchored uPAR requires Endo180 for rapid directional sensing during chemotaxis.
12933356 2004 Lipid raft compartmentalization of urokinase receptor signaling in human neutrophils.
12881310 2003 The kringle stabilizes urokinase binding to the urokinase receptor.
12761227 2003 Sequences within domain II of the urokinase receptor critical for differential ligand recognition.
12736046 2003 Association of plasma urokinase-type plasminogen activator and its receptor with clinical outcome in patients undergoing radical cystectomy for transitional cell carcinoma of the bladder.
12708473 2003 Urokinase-type plasminogen activator expression correlates with tumor angiogenesis and poor outcome in gastric cancer.
12704669 2003 Urokinase-mediated posttranscriptional regulation of urokinase-receptor expression in non small cell lung carcinoma.
12665524 2003 Binding of urokinase-type plasminogen activator receptor (uPAR) to the mannose 6-phosphate/insulin-like growth factor II receptor: contrasting interactions of full-length and soluble forms of uPAR.
12665127 2003 Regulation of CD11b/CD18 (Mac-1) adhesion to fibrinogen by urokinase receptor (uPAR).
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12479856 2003 The diphtheria toxin/urokinase fusion protein (DTAT) is selectively toxic to CD87 expressing leukemic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12405290 2002 Cyclooxygenase-2 expression correlates with uPAR levels and is responsible for poor prognosis of colorectal cancer.
12393744 2002 Urokinase receptor surface expression regulates monocyte adhesion in acute myocardial infarction.
12393547 2003 Convergence of the adhesive and fibrinolytic systems: recognition of urokinase by integrin alpha Mbeta 2 as well as by the urokinase receptor regulates cell adhesion and migration.
12376466 2002 Molecular proximity of seprase and the urokinase-type plasminogen activator receptor on malignant melanoma cell membranes: dependence on beta1 integrins and the cytoskeleton.
12297505 2002 The cleavage of the urokinase receptor regulates its multiple functions.
12244126 2002 Role of beta(3)-endonexin in the regulation of NF-kappaB-dependent expression of urokinase-type plasminogen activator receptor.
12195704 2002 Metalloproteases cleave the urokinase-type plasminogen activator receptor in the D1-D2 linker region and expose epitopes not present in the intact soluble receptor.
12194987 2002 Low density lipoprotein (LDL) receptor-related protein 1B impairs urokinase receptor regeneration on the cell surface and inhibits cell migration.
12180971 2002 Suppression of urokinase receptor expression by bikunin is associated with inhibition of upstream targets of extracellular signal-regulated kinase-dependent cascade.
12174885 The circulating urokinase plasminogen activator (uPA) and its soluble receptor (suPAR) are not up-regulated by the circulating P105 fraction of the HER-2/neu proto-oncogene: in vivo evidence from patients with advanced non-small cell lung cancer (NSCLC).
12138365 2002 Up-regulation of the urokinase-type plasminogen activator receptor by monocyte chemotactic proteins.
12130664 2002 Urokinase plasminogen activator receptor: Prognostic biomarker for endometrial cancer.
12124797 2002 Human breast adenocarcinoma cell lines promote angiogenesis by providing cells with uPA-PAI-1 and by enhancing their expression.
12115506 2002 Expression of UPA and UPAR is associated with the clinical course of urinary bladder neoplasms.
12084931 2002 Urokinase-urokinase receptor interaction mediates an inhibitory signal for HIV-1 replication.
12070711 2002 Interferon-alpha (Intron A) upregulates urokinase-type plasminogen activator receptor gene expression.
12023847 2002 Structural analysis of the interaction between urokinase-type plasminogen activator and its receptor: a potential target for anti-invasive cancer therapy.
12023845 2002 Haemostatic factors occupy new territory: the role of the urokinase receptor system and kininogen in inflammation.
11959893 2002 Targeting urokinase-type plasminogen activator receptor on human glioblastoma tumors with diphtheria toxin fusion protein DTAT.
11928822 2002 The urokinase plasminogen activator receptor in the regulation of the actin cytoskeleton and cell motility.
11928816 2002 Monocyte-expressed urokinase regulates human vascular smooth muscle cell migration in a coculture model.
11928807 2002 Growth factor-dependent proliferation and invasion of muscle satellite cells require the cell-associated fibrinolytic system.
11928806 2002 Inhibition of receptor-dependent urokinase signaling by specific Ser to Glu substitutions.
11903048 2002 Investigation of the role of Endo180/urokinase-type plasminogen activator receptor-associated protein as a collagenase 3 (matrix metalloproteinase 13) receptor.
11756447 2002 Urokinase-dependent human vascular smooth muscle cell adhesion requires selective vitronectin phosphorylation by ectoprotein kinase CK2.
11501527 2001 Ligand binding regions in the receptor for urokinase-type plasminogen activator.
11384978 2001 The putative tumor suppressor LRP1B, a novel member of the low density lipoprotein (LDL) receptor family, exhibits both overlapping and distinct properties with the LDL receptor-related protein.
11359936 2001 Direct binding of occupied urokinase receptor (uPAR) to LDL receptor-related protein is required for endocytosis of uPAR and regulation of cell surface urokinase activity.
11290596 2001 Expression and colocalization of cytokeratin 1 and urokinase plasminogen activator receptor on endothelial cells.
11097855 2000 Soluble urokinase receptor promotes cell adhesion and requires tyrosine-92 for activation of p56/59(hck).
11051819 2000 [cDNA cloning and sequencing of human urokinase receptor].
10749881 2000 The chemotactic action of urokinase on smooth muscle cells is dependent on its kringle domain. Characterization of interactions and contribution to chemotaxis.
10744708 2000 Identification of a urokinase receptor-integrin interaction site. Promiscuous regulator of integrin function.
10722370 2000 Possible role of the plasminogen receptor as a site of interaction of the human immunodeficiency virus p24 immunosuppressive heptapeptide Ch7 with the host immune system.
10636902 2000 A urokinase receptor-associated protein with specific collagen binding properties.
10537314 1999 Urokinase receptor interacts with alpha(v)beta5 vitronectin receptor, promoting urokinase-dependent cell migration in breast cancer.
9974409 1999 Urokinase activates the Jak/Stat signal transduction pathway in human vascular endothelial cells.
9417082 1998 The Jak/Stat pathway and urokinase receptor signaling in human aortic vascular smooth muscle cells.
9353320 1997 Urokinase receptor is associated with the components of the JAK1/STAT1 signaling pathway and leads to activation of this pathway upon receptor clustering in the human kidney epithelial tumor cell line TCL-598.
9030717 1997 Cell-surface acceleration of urokinase-catalyzed receptor cleavage.
8830783 1996 Is plasminogen activator inhibitor-1 the molecular switch that governs urokinase receptor-mediated cell adhesion and release?
8394346 1993 Localization of the disulfide bonds in the NH2-terminal domain of the cellular receptor for human urokinase-type plasminogen activator. A domain structure belonging to a novel superfamily of glycolipid-anchored membrane proteins.
8392005 1993 An alternatively spliced variant of mRNA for the human receptor for urokinase plasminogen activator.
8131971 1993 A novel urokinase receptor on monocyte-like macrophage cell line.
8049431 1994 The structure of the urokinase-type plasminogen activator receptor gene.
7605992 1995 A conserved TATA-less proximal promoter drives basal transcription from the urokinase-type plasminogen activator receptor gene.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7539799 1995 A novel form of dipeptidylpeptidase IV found in human serum. Isolation, characterization, and comparison with T lymphocyte membrane dipeptidylpeptidase IV (CD26).
3031025 1987 The receptor-binding sequence of urokinase. A biological function for the growth-factor module of proteases.
3023326 1986 Binding of single-chain prourokinase to the urokinase receptor of human U937 cells.
2544876 1989 Accessibility of receptor-bound urokinase to type-1 plasminogen activator inhibitor.
2156852 1990 The human receptor for urokinase plasminogen activator. NH2-terminal amino acid sequence and glycosylation variants.
1846368 1991 Cellular receptor for urokinase plasminogen activator. Carboxyl-terminal processing and membrane anchoring by glycosyl-phosphatidylinositol.
1689240 1990 Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis.
1325912 1992 Structural requirements for glycosyl-phosphatidylinositol-anchor attachment in the cellular receptor for urokinase plasminogen activator.
1324136 1992 Assignment of the human urokinase receptor gene (PLAUR) to 19q13.
1316922 1992 cDNA for Mo3, a monocyte activation antigen, encodes the human receptor for urokinase plasminogen activator.
1311495 1992 Assignment of the urokinase-type plasminogen activator receptor gene (PLAUR) to chromosome 19q13.1-q13.2.