Property Summary

NCBI Gene PubMed Count 499
PubMed Score 1988.79
PubTator Score 2077.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (28)

Disease log2 FC p
interstitial lung disease 1.100 4.3e-02
psoriasis 1.700 1.5e-04
glioblastoma 2.600 4.5e-05
osteosarcoma 2.359 2.5e-03
ependymoma 1.300 2.7e-03
cystic fibrosis 2.625 9.2e-07
non diabetic and post-ischemic heart fai... -1.200 2.6e-03
atypical teratoid / rhabdoid tumor 3.700 1.8e-05
medulloblastoma, large-cell 1.400 6.4e-05
primitive neuroectodermal tumor 1.300 1.9e-02
Atopic dermatitis 1.300 2.3e-04
tuberculosis -1.800 1.4e-05
primary pancreatic ductal adenocarcinoma 2.169 1.1e-03
non-small cell lung cancer 2.240 7.1e-15
intraductal papillary-mucinous adenoma (... -1.600 7.3e-03
colon cancer 1.700 8.0e-03
ulcerative colitis 3.400 4.1e-07
pancreatic cancer 2.300 3.1e-03
Multiple Sclerosis -1.100 6.5e-04
Breast cancer 2.600 2.5e-02
interstitial cystitis 1.800 2.2e-04
lung adenocarcinoma 2.200 4.4e-07
adult high grade glioma 2.200 4.1e-04
pilocytic astrocytoma 2.800 2.2e-08
invasive ductal carcinoma 1.332 4.7e-02
nasopharyngeal carcinoma 1.500 1.6e-05
gastric carcinoma 2.000 2.7e-02
ovarian cancer 3.900 3.5e-05

Synonym

Accession P00749 B4DPZ2 Q15844 Q16618 Q53XS3 Q5SWW9 Q969W6 U-plasminogen activator
Symbols ATF
QPD
UPA
URK
u-PA
BDPLT5

Gene

PANTHER Protein Class (3)

PDB

1C5W   1C5X   1C5Y   1C5Z   1EJN   1F5K   1F5L   1F92   1FV9   1GI7   1GI8   1GI9   1GJ7   1GJ8   1GJ9   1GJA   1GJB   1GJC   1GJD   1KDU   1LMW   1O3P   1O5A   1O5B   1O5C   1OWD   1OWE   1OWH   1OWI   1OWJ   1OWK   1SC8   1SQA   1SQO   1SQT   1U6Q   1URK   1VJ9   1VJA   1W0Z   1W10   1W11   1W12   1W13   1W14   2FD6   2I9A   2I9B   2NWN   2O8T   2O8U   2O8W   2R2W   2VIN   2VIO   2VIP   2VIQ   2VIV   2VIW   2VNT   3BT1   3BT2   3IG6   3KGP   3KHV   3KID   3M61   3MHW   3MWI   3OX7   3OY5   3OY6   3PB1   3QN7   3U73   4DVA   4DW2   4FU7   4FU8   4FU9   4FUB   4FUC   4FUD   4FUE   4FUF   4FUG   4FUH   4FUI   4FUJ   4GLY   4H42   4JK5   4JK6   4JNI   4JNL   4K24   4MNV   4MNW   4MNX   4MNY   4OS1   4OS2   4OS4   4OS5   4OS6   4OS7   4X0W   4X1N   4X1P   4X1Q   4X1R   4X1S   4XSK   4ZHL   4ZHM   4ZKN   4ZKO   4ZKR   4ZKS   5HGG  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
720519 confirmatory 16 / 44 / 827 qHTS for Inhibitors of Cell Surface uPA Generation: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (438)

PMID Text
26978018 The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor
26846181 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26782341 1,25D3 works as a modifier of NF-kappaB/GPX1/uPA expression, inhibiting cisplatin-resistance and cell invasive ability of salivary adenoid cystic carcinoma cells
26707376 Resveratrol inhibited hypoxia-induced HIF-1alpha protein expression. Resveratrol also suppressed hypoxiainduced expression of metastatic-related factors, uPA and MMP2.
26643086 These findings strongly support the use of uPA/PAI-1 together with clinic-pathological parameters as an evidence-based, clinically relevant and inexpensive decision tool in the routine of a breast center.
26504024 High cytoplasmic expression of uPA is associated with cells of rectal cancer and metastases of perienteric lymph nodes.
26317203 Results found high levels of uPA and uPAR exclusively in metastatic osteosarcoma (OS)cells and suggest that malignant conversion of OS cells to uPA/uPAR axis in an autocrine and paracrine fashion.
26166362 it was found that the recombinant fusion protein uPA17-34-KPI(kunitz-type protease inhibitor ) inhibited the invasion and metastasis of ovarian tumors
26050228 data on the stromal macrophages immunoreactivity of uPAR, MMP-2, and MMP-9 in a few small cell lung cancer (SCLC) and lung squamous cell carcinoma (SCC) biopsies was included. uPAR, MMP-2, and MMP-9 were confirmed in stromal cells including macrophages
26033187 u-PA is a dysregulated gene involved in the tumorigenesis, bio-pathological features and outcomes of EEC.
26027394 The predominance of uPA over PAI-1 in the gastric mucosa vessels and epithelial cells can play a role in the development of gastric mucosa bleeding.
25993872 Activation of uPA and MMP-3 in perifocal zone of the tumor can serve as an indexof its invasive activity.
25979345 Porphyromonas gingivalis-derived RgpA-Kgp complex activates the macrophage uPA.
25962429 DIM can influence the cell migratory and invasive properties of human colorectal cancer cells and may decrease the invasive capacity of colorectal cancer through downregulation of uPA and MMP9 mediated by suppression of the transcription factor FOXM1
25744057 Crystal structure of uPA bound with cyclic peptidic inhibitors.
25706093 Studied urokinase-type plasminogen activator regulation in cigarette smoke extract (CSE)-induced EMT in human small airway epithelial cell lines (HSAEpiCs)and in the small airway epithelium of COPD patients.
25641046 Data suggest that enhanced levels of uPA in breast cancer modulate the mitogenic effects of EGF which helps to better understand breast cancer pathogenesis.
25555911 Data indicate that urokinase-type plasminogen activator (uPA) activates epithelial sodium channel, gamma subunit (ENaC gamma) through catalytic activity-dependent proteolytic modification.
25554417 we found that in HS fibroblasts (HFs) miR-181c and miR-10a were differentially-expressed and targeted uPA and PAI-1, respectively. The production of Type 1 collagen (Col1) was inhibited by miR-181c knockdown or miR-10a overexpression
25544710 Silencing of ETV4 suppresses invasion of prostate cancer cells by inhibiting the expression of uPA/uPAR as well as (MMP)-2 and MMP-9
25433194 IL-17 may act as chemotropic factor for peripheral blood-Mesenchymal stem cellss by incrementing cell motility and uPA expression during inflammation development.
25394558 Taking uPA(1-43) amino acids specifically binding to uPAR as targeted part of fusion protein, and making use of antitumor activity of melittin, the recombinant fusion protein it was able to inhibit growth of ovarian tumors .
25371209 Data indicate that mucin 1 (MUC1) forms a complex with NF-kappaB p65 transcription factor and binds to urokinase-type plasminogen activator (uPA) promoter, and thereby induces uPA expression.
25323935 Data show that the plasminogen activator urokinase (uPA)/plasminogen activator inhibitor 1 (PAI-1) ratios in prostate cancer (PCa) patients to be significantly higher than in benign prostatic hyperplasia (BPH) patients.
25244504 uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2
25215905 miR-193b inhibits the expression of stathmin 1 (STMN1) and urokinase-type plasminogen activator (uPA) in Panc-1 cells.
25082749 In human coronary vascular smooth muscle, uPA induces uPAR-independent, domain-dependent smooth muscle cell proliferation through transactivation of EGFR by a plasmin-mediated, ADAM-induced, and HB-EGF-dependent process.
24952395 SNP P141L associated with collateral circulation in coronary artery disease
24877154 The mRNA expression levels of uPA, its receptor (uPAR), and its inhibitor type 1 (PAI-1) were analyzed in corresponding malignant and adjacent nonmalignant tissue specimens from 132 PCa patients by quantitative PCR.
24822208 Studied the relationship between uPA gene polymorphisms and clinical manifestations of idiopathic membranous nephropathy.
24807734 we are reporting the strong correlation among uPA and ECM proteins in newly diagnosed MM patients of different stages.
24756697 These effects were mediated by the efficient conversion of pro-uPA to active uPA and high phosphorylation levels of ERK detected in the PANC-1 cells expressing exogenous polyserase-1.
24702774 IL-33 is involved in u-PA-driven angiogenesis, a process that has been shown before to be linked to inflammation in various pathologies.
24648800 Suggest a possible protective effect of podocyte uPA/uPAR expression against interstitial fibrosis in IgA nephritis.
24626561 IL-1beta-induced urokinase plasminogen activator expression via activation of the ERK1/2 and NF-kappaB pathways, which results in invasion of gastric cancer cells.
24616477 Urokinase plasminogen activator is a central regulator of macrophage three-dimensional invasion, matrix degradation, and adhesion.
24610082 High u-PA expression is associated with metastasis in breast cancer.
24529115 results of this study suggest that uPA decreases the removal of HDL-cholesteryl ester in the liver via suppression of the hepatic scavenger receptor class B type I (SR-BI)expression
24481457 Decreasing uPA levels sensitized cancer cells to TRAIL, leading to markedly increased apoptosis.
24479343 Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines
24434139 TMPRSS4 directly converted inactive pro-uPA into the active form through its proteolytic activity. Conditioned medium from cells overexpressing TMPRSS4 showed that the active TMPRSS4 protease domain is released and is associated with the plasma membrane.
24340014 Oncogenic K-Ras and loss of Smad4 mediate invasion by activating an EGFR/NF-kappaB Axis that induces expression of MMP9 and uPA in human pancreas progenitor cells.
24304137 uPAR, IL-33, and ST2 values as a predictor of subclinical chorioamnionitis in preterm premature rupture of membranes.
24217605 The uPA/uPAR angiogenesis regulatory system supports the endothelial cells that need to migrate, invade the extracellular matrix, survive, proliferate, and to re-establish new contacts with cells and the surrounding matrix. (Review)
24111848 Plasminogen stimulates airway smooth muscle cell proliferation in a manner mediated by urokinase and annexin A2.
24057344 High preprocedural plasma uPA and serum CRP levels are indicative of angina recurrence after successful PTCA, and are valuable for the prognosis of restenosis.
24023701 SERPINE2 and PLAU are involved in cumulus expansion and oocyte maturation.
23985164 The expression of the uPA system positively correlates with peritoneal metastasis of gastric cancer.
23978400 The uPA expression was significantly correlated with TMPRSS4 expression in human lung and prostate cancers.
23900236 Analysis revealed a positive correlation between u-PA and MMPs and a negative correlation between u-PA/MMPs and TIMPs.
23898067 The expression of urokinase-type plasminogen activator (uPA) and plasminogen activator inhibitor-1 (PAI-1) was up-regulated in co-cultures with squamous cell carcinoma cells but not with normal oral keratinocytes.
23897640 We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for PLAU
23864708 Results show that uPA regulates Lhx2 expression by suppressing expression of miR-124 and p53 expression. These results demonstrate that regulation of gene transcription by uPA contributes to pancreatic cancer cell stemness and clinical lethality
23848154 The beta sheet in the growth factor-like domain is not necessary for high affinity binding of uPA to uPAR.
23813610 T allele of rs2227564 polymorphism in PLAU gene could increase the effects on risk of Alzheimer's disease
23812296 The effects of UPA/UPAR on migration of lipid-loaded cells occurred through the binding to LRP-1.
23661254 Analysis revealed a positive correlation between u-PA and MMPs and a negative correlation between u-PA/MMPs and TIMPs. These findings suggest the therapeutic potential of NM in treatment of adult sarcomas
23628797 uPA has a major role in cholesterol biosynthesis; PLAU Pro141Leu (rs2227564) is significantly associated with serum lipid levels in a Japanese population
23621237 The findings provide evidence that the rs2227564 C/T SNP in the u-PA gene is associated with the development of oral tongue squamous cell carcinoma.
23615713 Results show that stromal cell-derived factor-1 (SDF-1) enhanced ovarian cancer cell invasion through alphavbeta6 integrin-mediated urokinase-type plasminogen activator (uPA) expression via the p38 MAPK and PI3 K/Akt pathway.
23597113 These data support the hypothesis that uPA upregulation stimulated by macrophages may play an active role in the onset of osteoarthritis and in the shear-stress protection against this induction.
23536772 Urokinase plasminogen activator induces pro-fibrotic/m2 phenotype in murine cardiac macrophages.
23532423 P141L and 3'-UTR polymorphisms of the urokinase gene are not associated with urolithiasis in a Japanese population
23441133 In conclusion, our data suggest that radiation-mediated hypomethylation triggers uPA expression in meningioma cells.
23392805 Dose-dependent increases in uPA and IL-8 expression were detected following TRAIL stimulation in pancreatic ductal adenocarcinoma cells.
23350235 the effect of the mu-opioid receptor selective peptide, morphiceptin, and its two synthetic analogs on mRNA and protein levels of MMP-9
23333304 HIV-1 Vif upregulates the expression of plasminogen activator, urokinase (PLAU) in Vif-expression T cells
23322578 UVA stimulated the production of uPA, a key factor in the modulation of extracellular matrixes, inflammatory processes, and angiogenesis.
23169000 PLAU is particularly important for memory Tregs and PLAU mediates Treg suppressor function via STAT5 and ERK signaling pathways.
23064953 Complexes between alpha2-macroglobulin and urokinase were detected in alveolar edema fluids as well as in lungs of patients with acute lung injury/acute respiratory distress syndrome where they were located mainly in close proximity to epithelial cells.
23059760 study investigated the role of uPA, PAI-1, MMP-2, and TIMP-2 in formation of self-assembled network in the 2D co-ulture of bone marrow stromal cells and HUVECs; data showed that uPA played an important role in network formation, while the process appears independent on TIMP-2 but involved MMP-2
22994764 UPA and VEGF protein expression of the high microvessel density (MVD) group was significantly lower than in the low MVD group (P < 0.05).
22986534 Data indicate that knockdown of interleukin enhancer-binding factor 3 (ILF3) leads to the increased levels of mature urokinase-type plasminogen activator (uPA) mRNA-targeting miRNAs miR-193a, miR-193b and miR-181a.
22927998 novel functions of gelsolin in colorectal tumor cell invasion through its modulation of the uPA/uPAR cascade
22906080 The detrimental effects of atherogenic LDL on VSMC are mediated by a decrease and delocalization of the UPA-UPAR interaction that result in an impairment of cytoskeleton dynamics and adhesion capacity affecting cell phenotype and function.
22797919 these data suggest that PKD2 and PKD3 coordinate to promote prostate cancer cell invasion through p65 NF-kappaB- and HDAC1-mediated expression and activation of urokinase-type plasminogen activator (uPA).
22797075 urokinase plasminogen activator is involved in mediating the tumor-suppressing effects of CFTR
22707264 Data suggest that lycopene, a dietary component, inhibits angiogenesis; lycopene appears to down-regulate signal transduction by inhibition of uPA and MMP2 (matrix metallopeptidase 2) via vascular endothelial growth factor receptor 2 signaling.
22702340 In papillary thyroid carcinoma BRAFV600E is associated with increased expression of the urokinase plasminogen activator and its cognate receptor, but not with disease-free interval.
22684547 SphK1 promoting the secretion of MMP-2/9 and uPA via activation of ERK1/2 and suppression of p38 MAPK pathways maybe the molecular mechanisms for its regulation of the malignant behavior of colon cancer cell.
22575880 aminoterminal fragment requires NAD(P)H oxidase activity through a Gbetagamma-, rac-, and src-mediated pathway to facilitate transactivation of EGFR and vascular smooth muscle cell migration
22470492 The downregulation of uPA/uPAR results in increased integrin alphavbeta5 cell-surface protein levels that regulate the activity of beta1 integrins, promoting characteristics of the persistent Myofibroblasts.
22467324 uPA, uPAR, and PAI-1 were quantified by enzyme-linked immunosorbent assay (ELISA) in extracts of 226 breast tumor biopsies.
22354580 Individuals with uPA/PAI-1 CC/4G5G allele were in high susceptibility for cervical neoplasia. The combined polymorphism of uPA/PAI-1 might diminish the ability of PAI-1 to inhibiting cervical cancer carcinogenesis when PAI-1 alone as the role of inhibitor
22294827 Data show that urokinase plasminogen activator expression correlates with lymphatic invasion and metastasis in vivo and is required for CCA cell invasion in vitro, suggesting its potential as a therapeutic target.
22291969 HDAC inhibitor trichostatin A (TSA) increased the expression of TIMP-1 and TIMP-3 while decreased MMP-2, MMP-9 and uPA and have an inhibitory effect on trophoblast invasion.
22280367 suggest that uPA promotes cell migration by binding to fibulin-5, initiating its cleavage by plasmin, which leads to its dissociation from beta1-integrin and thereby unblocks the capacity of integrin to facilitate cell motility
22199285 Resveratrol reduces TNF-alpha-induced U373MG human glioma cell invasion through regulating NF-kappaB activation and uPA/uPAR expression
22177802 Small hairpin RNA against uPA and/or uPAR increased secretion of TIMP-1, which is known to enhance SVEGFR1 secretion in endothelial cells and glioblastoma cells.
22166006 Posttranscriptional regulation of uPA involves the newly recognized pathway of approximately 40 kDa cytoplasmic-nuclear shuttling protein ribonuclease reductase M2 (RRM2) present in the uPA mRNA 3'untranslated region (UTR).
22102275 Studies indicate that the genetic cause of QPD is a tandem duplication mutation of the uPA gene, PLAU, which upregulates uPA expression in megakaryocytes by an unknown mechanism.
22004682 down regulation of uriokinase plasminogen activator (uPA) or uPA receptor results in the inhibition of glioma cell invasion via inhibition of Notch 1 receptor cleavage, signaling and endosomal trafficking of the Notch 1 receptor
21989445 Confirmed the correlation between elevated uPA values & an aggressive course of invasive breast cancer.
21965736 A possible interaction between IL-6, OSM, u-PA and VEGF in prostate cancer was investigated.
21913037 MMP-9 and uPA might be involved in the activation of pro-MMP-13 through unknown mechanisms in arthritic diseases.
21858104 Data show that kahweol inhibits HUVEC MMP-2 and urokinase involved in angiogenesis.
21833477 These results indicate that urokinase plasminogen activator, plasminogen activator urokinase receptor and maspin expression patterns may be useful markers for evaluating the clinical course or prognosis of oral squamous cell carcinoma patients
21819230 In the Brazilian population, genetic variations in both uPA and TAFI were not relevant to endometriosis and/or infertility.
21798735 TGF-beta1-induced activation of Smad3 is the critical step for the uPA upregulation and E-cadherin downregulation
21761413 No association between uPA (rs4065)polymorphism and endometrial carcinoma risk
21744990 High Urokinase expression is associated with poor treatment response in colorectal carcinoma.
21711960 increased expression in sinonasal mucosa of chronic rhinosinusitis patients with polyps
21709151 Macrophage-derived uPA transgene promotes muscle regeneration by inducing macrophage migration, angiogenesis, and myogenesis.
21670079 miR-193a affects invasive growth through PLAU. A pathway in which Max & RXRalpha inhibit miR-193a activates the PLAU & K-Ras oncogenes is important for distinct aspects of cellular transformation.
21669207 Active uPA was found to be flexible with a random conformation of the amino-terminal fragment domain with respect to the serine protease domain.
21627387 A C to T polymorphism of urokinase plasminogen activator (P141L) is associated with Helicobacter pylori infection.
21574189 Results show that silibinin decreased MMP-2, MMP-9, u-PA, p-p38, and p-Erk1/2 expressions in a concentration-dependent manner.
21567400 The effect of SDF-1 on colorectal cancer cell signaling and uPA expression is mediated by the CXCR4/beta1 integrin axis.
21426933 The targeting uPA not only inhibited established intracranial tumors but also radiation-induced recruitment of endothelial cells and monocytes towards the tumor region.
21316840 PAI-2 is capable of inhibiting uPA in the presence of PAI-1, particularly on adherent cells in the presence of vitronectin
21242962 Data show that p15/miR-23b/uPA are involved in HPV-16 E6-associated cervical cancer development.
21219832 High expression of uPA and ET-1 were found in lung adenocarcinomas.
21199867 we report a strategy to generate a PAI-1.uPA(S195A) Michaelis complex and present its crystal structure at 2.3-A resolution
21181094 Anti-tumor efficacy of down-regulation of uPA or uPAR in medulloblastoma tumors to target hypoxia-induced cell EMT, invasion and migration, to achieve better therapeutic outcomes in the treatment of malignant medulloblastoma.
21174062 Specific suppression of osteopontin also inhibited matrix metalloproteinase 2 (MMP-2) and urokinase-type plasminogen activator (uPA) expression in HCCLM6 cells.
21106716 The study demonstrated that in papillary thyroid cancer the increased gene expression of uPA and cognate receptor is associated with tumor invasiveness
21104439 OPN enhanced hepatocellular carcinoma cells invasion through interaction with its receptor CD44v6 and increased MMP-2 and uPA expressions.
21076612 Data show that GATA6 is an important regulator of uPA gene expression, and the dysregulated expression of GATA6 contributes to colorectal tumorigenesis and tumor invasion.
21071923 Curcumin facilitates fibrinolysis and cellular migration during wound healing by modulating urokinase plasminogen activator expression.
20937265 role of single nucleotide polymorphism of uPA and uPAR in non-small cell lung cancer
20937265 Observational study of gene-disease association. (HuGE Navigator)
20931209 The increase of PAI-1 and uPA can contribute to the enhancement of metastasis and invasive potential of tumour cells.
20805979 uPA/uPAR downregulation suppresses angiogenesis in endothelial cells induced by glioblastoma cell lines
20740581 uPA levels were increased in high grade tumours, whereas plasminogen activator inhibitor 1 was elevated in cases with venous invasion
20708412 In Buerger's disease, PAI-1 was strongly expressed around the internal elastic lamina, while both uPA and MMP-3 were slightly recognized on vessel walls.
20693403 airway smooth muscle activation of plasminogen by uPA is accelerated in a collagen-rich environment in which the inhibitory effect of TGF-beta is attenuated in association with greater uPA expression induced via beta1-integrin signaling
20673868 Observational study of gene-disease association. (HuGE Navigator)
20651370 MPO, urokinase, XPA and XPD polymorphisms are not related to leiomyoma susceptibilities.
20645833 investigation of regulation of gene expression of uPA: up-regulation of uPA (& proto-oncogene c-ets-1) by basic fibroblast growth factor in invasiveness of ovarian cancer; involvement of proto-oncogene c-ets-1 as additional regulatory factor
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584616 The cerebrospinal fluid uPA and MMP-9 levels of the eosinophilic meningitis associated with angiostrongyliasis patients were significantly higher than those of the controls (p<0.001).
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20518747 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20445443 The activation by u-PA was enhanced by 2.86 microg/ml of S-2, 4-6-fold by of 32.4 mmol/l of lysine or 5.4 mmol/l of 6-aminohexanoic acid and 14-16-fold enhancement by addition of both S-2 and lysine or S-2 and 6-AH showing a synergistic effect.
20403162 Demonstrate increased expression of uPA and uPAR in human seminomas with respect to normal testis tissues, which may be relevant in testicular cancer progression.
20369484 Increased plasma levels of uPA and TGF-beta1 are associated with the occurrence and development of preeclampsia.
20337595 Activation of human pro-urokinase by unrelated proteases secreted by Pseudomonas aeruginosa
20204407 Statistically significant correlation between mRNA and protein expression of uPA in breast cancer.
20198323 A combination approach using uPA and uPAR siRNA therapy along with radiation treatment produced target-specific effects with regard to inducing apoptosis in meningioma.
20097831 Both tissue-type PA (tPA) and urokinase-type PA (uPA) bind to NMDA-R1 and reverse this effect, thereby enhancing acetylcholine-induced tracheal contractility.
20052287 predominantly associated with poised (S5p+S2p-) factories prior to activation and localized at the chromosome territory interior
20051950 As expression of members of the uPA system in tumour tissue and serum is additively correlated with prognosis of soft tissue sarcoma patients.
20043086 overexpression of ErbB2 promotes invasive and migratory abilities of H-Ras-activated MCF10A human breast epithelial cells through upregulation of matrix metalloproteinase (MMP)-13 and urokinase-type plasminogen activator (uPA).
20039121 Patients with high uPA and/or PAI-1 levels in the primary tumor may benefit more from the adjuvant anthracycline-containing regimens than from CMF-based chemotherapy
20036101 Intramuscular electroporation of TIMP-1 linked to the amino terminal fragment of urokinase inhibits vein graft thickening in vein grafts in carotid arteries of hypercholesterolemic mice.
20015050 HGF is activated by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
20007542 Tandem duplication of the urokinase plasminogen activator gene is associated with Quebec platelet disorder.
20007542 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903858 de-N-acetyl GM3 stimulates migration and invasion of melanoma cell lines by increasing the expression and activation of urokinase-like plasminogen activator
19889475 Observational study of gene-disease association. (HuGE Navigator)
19845941 These novel findings suggest a model in which CK8, together with uPA, plasminogen and fibronectin, constitutes a signaling platform capable of modulating cell adhesion/growth-dependent signal transduction in breast tumor cells.
19826838 Results suggest that uPA could be considered for further studies as a possible useful therapeutic target in breast cancer.
19776673 Preoperative mucosal uPA and plasma PAI-1 protein expression could possibly be used as prognostic factors in rectal cancer
19740518 uPA, but not uPAR, is an independent prognostic factor and that this negative effect on survival is relevant specifically for mismatch repair-proficient colorectal cancers.
19735728 Upon urokinase plasminogen activator stimulation, UPAR, Matrix metalloproteinases, integrin alphavbeta3 and NSMASE2 form a signaling complex that take part in mitogenic signaling in ECV304 cells.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19729488 The uPA-plasmin system participates in prostate carcinoma-high disseminating intravasation, possibly via promoting tumor cell matrix invasion and facilitating development of VEGF-dependent angiogenic blood vessels.
19723042 Data show that ehe expression level of uPA and MMP-2 was not associated with the grade of CIN lesions.
19703758 Monocyte urokinase-type plasminogen activator up-regulation reduces thrombus size in a model of venous thrombosis.
19701247 miR-193b is closely associated with clinical metastasis and identifies miR-193b potentially targets uPA transcripts.
19693769 3,3'-Diindolylmethane (B-DIM) down-regulates uPA-uPAR in aggressive breast cancers but in the absence of uPA-uPAR, B-DIM can directly inhibit VEGF and MMP-9 leading to the inhibition of cell growth and migration of breast cancer cells
19616049 Soluble urokinase receptor conjugated to carrier red blood cells binds latent pro-urokinase and alters its functional profile.
19546228 EMT was reversed by silencing expression of endogenously produced urokinase-type plasminogen activator (uPA), which is necessary for uPAR-dependent cell signaling.
19536843 mRNA expression for uPA was significantly lower in liver metastases compared with primary breast tumours and lymph node metastases.
19526059 Observational study of gene-disease association. (HuGE Navigator)
19513384 The expression of nm23 protein positively correlated with tPA level (r(s)=0.4; p=0.01) and did not correlate with the content of uPA and PAI-1 in tumors. Data confirm the role of the studied proteins in invasion and metastases of malignant tumors
19497963 Urokinase activates macrophage PON2 gene transcription via the PI3K/ROS/MEK/SREBP-2 signalling cascade mediated by the PDGFR-beta.
19490101 Results show that overexpression of miR-23b leads to uPA and c-met downregulation and to decreased migration and proliferation abilities of HCC cells.
19475533 Tumor stroma is the predominant UPA- expressing tissue in human breast cancer: prognostic impact is reported.
19436306 LPS promotes tumour cell ECM adhesion and invasion through activation of the u-PA system in a TLR-4- and NF-kappaB-dependent manner.
19403319 the 20-26 amino acid residues of uPA are important for the binding between uPA and uPAR, and that the electrostatic interactions between the charged amino acid residues existing in both uPA and uPAR have large contribution to the binding
19394555 Cell migration in response to the amino-terminal fragment of urokinase requires epidermal growth factor receptor activation through an ADAM9/10-mediated mechanism.
19298527 survivin is an essential mediator of arthritogenic properties of uPA regulating its synthesis in synovial fibroblasts and uPAR expression in leucocytes
19272641 results suggest that uterine natural killer cells may regulate extravillous trophoblast invasion and spiral artery remodeling via the uPA system.
19232508 an increased activation of the uPA system possibly contributs to the inflammatory phenotype seen in subgroups of common variable immunodeficiency patients.
19177205 The uPA up-regulation increased LASP-1 expression and that both were implicated in SKHep1C3 motility. siRNA LASP-1 inhibition showed that LASP-1 was involved in actin microfilaments organization of SKHep1C3 cells.
19176991 Urokinase & its receptor UPAR exert a regulatory effect on physiologic cell migration as well as tumor growth and metastasis. Review.
19157142 The positive expression of uPA and uPAR in hypopharyngeal carcinoma were significantly higher than in normal tissue.
19147749 the involvement of Notch1 in human PCa invasion and that silencing of Notch1 inhibits invasion of human PCa cells by inhibiting the expression of MMP9 and uPA
19133257 Results demonstrate that SHP-2 plays an important role in uPA-directed signaling and functional control of human VSMC and suggest that this phosphatase might contribute to the pathogenesis of the uPA-related vascular remodeling.
19132247 Report recombinant production of a hybrid plasminogen activator composed of surfactant protein B and low-molecular-weight urokinase.
19123477 analysis of urokinase, urokinase receptor and plasminogen activator inhibitor-1 in colon cancer liver metastases
19117638 Observational study of gene-disease association. (HuGE Navigator)
19115132 The higher expression of uPAR/uPA in most of the opportunistic cerebral lesions supports their role in these diseases, suggesting their contribution to tissue injury.
19102416 uPA exon 6 C/T polymorphism is associated with invasive phenotype of gastric cancer, but not with susceptibility or survival of gastric cancer. uPA intron 7 is a silent polymorphism.
19101688 uPA and haptoglobin are produced by the cancer cells and are not taken up by stromal elements.
19097143 These results demonstrated that in A549 cells, activation of p50/p65 heterodimer through sequential activation of PKC alpha-JNK-NIK-IKK beta-NF-kappaB was required for IL-1 beta-induced uPA expression associated with migration of tumor cells.
19088796 Data show the effects of nitric oxide and hydrogen peroxide on the expression of tissue-type plasminogen activator (t-PA), urokinase-PA, u-PA receptor, and plasminogen activator inhibitor type 1 (PAI-1) in human umbilical vein endothelial cells.
19029443 overexpression of uPA in Quebec platelet disorder emerges with megakaryocyte differentiation, without altering the expression of flanking genes
19020551 Carcinoembryogenic antigen-related cell adhesion molecule (CEACAM)-1 and the urokinase plasminogen activator (uPA)/uPA-receptor (uPAR) pathway were identified as possible mediators in HGF-induced keratinocyte migration.
18997817 uPA not only generates active PDGF-DD, but also regulates its spatial distribution, provides novel insights into the biological function of PDGF-DD.
18988861 mutation in an uncharacterized cis element near PLAU is the cause of Quebec platelet disorder
18977241 Observational study of gene-disease association. (HuGE Navigator)
18954937 suPAR, prevents the interaction of urokinase with membrane-anchored uPAR on residual normal cells.
18949356 uPA/uPAR downregulation inhibits radiation-induced migration, invasion and angiogenesis in IOMM-Lee meningioma cells and decreases tumor growth in vivo.
18940913 uPAR and beta1-integrin interactions are essential to signals induced by integrin matrix ligands or uPA in lung cancer cells.
18824154 uPA-binding loops of ECRG2 are in correspondence with the reactive site loops for binding of serine proteinase in turkey ovomucoid third domain (OMTKY3).
18788551 uPA and uPAR in the synovial fluid may play a role in the pathogenesis of temporomandibular disorders.
18714186 Determination of serum CATB and plasma UPA levels may be useful to identify patients at a higher risk for progression to cancer.
18691743 the plasma levels of uPA and uPAR are closely related to the degree and period of inflammation in patients with acute or chronic hepatitis B, and that uPA and uPAR might be important indicators for disease progression
18600101 Evaluation of urokinase plasminogen activator in urine from individuals with Quebec platelet disorder.
18599586 Report increased expression of uPA by Helicobacter pylori in gastric epithelial cells.
18570153 uPA expression in metaplastic, dysplastic, and esophageal cancer tissue is associated with neoplastic progression of esophageal lesions
18519237 The results of this study support previous observations linking PAI-1 with airway remodeling and uPA with cellular inflammation. Moreover, the observed effect of uPA seems to be independent of its fibrynolytic activity.
18511987 Observational study of gene-disease association. (HuGE Navigator)
18491991 The pathogenesis of idiopathic pulmonary fibrosis is complex & the urokinase-type plasminogen activator (uPA)/plasminogen system participates in the repair process. Review.
18478929 NF-kappaB-mediated up-regulation of uPA expression is responsible for EGF-induced invasiveness in pancreatic cancer cells.
18466392 The expressions of both uPA mRNAs in the gastric cancer cells increased obviously (12-fold and 3-fold, respectively) with H. pylori stimulation.
18439850 the uPA system may be involved in the progression of prostate cancer
18436804 Urokinase plasminogen activator upregulates paraoxonase 2 expression in macrophages via an NADPH oxidase-dependent mechanism.
18390474 observations confirm a new role for p53 as a uPA mRNA binding protein that down-regulates uPA mRNA stability and decreases cellular uPA expression
18376415 reports the crystal structures of uPAR in complex with both urokinase (uPA) and vitronectin and reveal that uPA occupies the central cavity of the receptor, whereas vitronectin binds at the outer side of the receptor
18376307 UPA expression was significantly up-regulated in pancreatic ductal adenocarcinoma.
18362146 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18355442 uPA-mediated direct activation of MMP-9 may promote glioblastoma cell invasion.
18337556 upon cell binding and internalization, single-chain uPA (scuPA) translocates to the nucleus within minutes. Nuclear translocation does not involve proteolytic activation or degradation of scuPA.
18331597 SAK reduces tPA/uPA-mediated Plg activation by means of SAK.Plg complex formation, consequently downregulating tPA/uPA-induced fibrinolysis.
18321763 TSP-1 promotes human follicular thyroid carcinoma cell invasion mainly through up-regulation of the urokinase-dependent activity
18257282 The plasma uPAR and uPA levels in nosebleed patients before treatment is higher than that in normal group.
18240004 Urokinase 3"-UTR T/C gene polymorphism seems to appear more commonly in children with recurrenct calcium oxalate stone disease than in healthy children and in those with stones for the first time.
18240004 Observational study of gene-disease association. (HuGE Navigator)
18239069 Inactivation of FOXO3a after GR activation is an important mechanism contributing to GC-mediated repression of uPA gene expression in breast epithelial and cancer cells.
18237545 Together, the data indicate that SAA enhances plasminogen activation and suggest its possible role in plasmin(ogen)-mediated colon cancer progression.
18208536 Each additional copy of the minor allele PLAU-3995 (Pro41Leu,(rs2227564) was associated with higher log(D-dimer) levels.
18202522 IL-1beta stimulates uPA production via activation of NFkappaB and tyrosine phosphorylation, and also secretion of the enzyme, and that the uPA/plasmin system appears to be involved in inflammation in human dental pulp.
18196271 Data show that fibroblastic inflammatory reaction around the biopsy channel affects stromal uPA and PAI-1 expression, which possibly leads to falsely increased enzyme levels in ELISA.
18193533 In human renal tissues, protein C inhibitor and urinary plasminogen activator colocalized in the cytoplasm of renal proximal tubular epithelial cells
18177545 protein kinase C synergistically enhances the secretion of uPA in TNF-alpha-stimulated human dental pulp cells
18076013 The multimarker phenotype of the absence of CD8+ TILs, loss of p27, and positive uPA expression was predictive of an adverse prognosis in patients with lymph node-negative, MMR-proficient colorectal cancer.
18053985 Myeloma-osteoclast interactions stimulated the production of TRAP, cathepsin K, MMP-1, -9, and uPA
18048089 The carotid atherosclerosis is independently related to uPA/its soluble receptor system in dialysis patients
17994220 The urokinse haplotype CGCCCC is a genetic risk fctor for higher mortality and more severe clinical outcome with infection-associated acute lung injury.
17994220 Observational study of gene-disease association. (HuGE Navigator)
17986506 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17974965 In xenograft glioblastoma mouse model and in vitro invasion assay, LRP-deficient cells, which secreted high levels of uPA, invaded the surrounding normal brain tissue, whereas the LRP-overexpressing and uPA-deficient cells did not invade normal brain.
17949787 Elevated expression of MMP-1 and urokinase plasminogen activator can be used to identify patients with a worse prognosis in skull base chordoma.
17934860 Observational study of gene-disease association. (HuGE Navigator)
17923479 HDAC1 knockdown by small interference RNA stimulated uPA expression and cancer cell invasion.
17921261 data of study population indicate a higher ETS2 RNA concentration compared with uPA in the case of bladder cancer, resulting in an increased ETS2:uPA RNA ratio in urine
17880283 review of uPA - uPAR interactions with membrane proteins to modify signal transduction pathways and their role in oral squamous cell carcinoma
17877801 Observational study of gene-disease association. (HuGE Navigator)
17709546 uPA plays a major role in inducing MMP-1 production in activated human monocytes, which is mediated by a plasmin-dependent mechanism involving signaling through the annexin A2 heterotetramer.
17681345 Urokinase plasminogen activator (uPA) stimulates cholesterol biosynthesis in macrophages through activation of SREBP-1 in a PI3-kinase and MEK-dependent manner
17661167 Observational study of gene-disease association. (HuGE Navigator)
17657740 simultaneous downregulation of uPAR and matrix metalloprotease-9 using RNAi technology may provide an effective tool for breast cancer therapy
17654528 we demonstrated that tyrosine phosphorylation of EGFR and the autocrine expression of uPA and HB-EGF depend on the activity of c-jun amino-terminal kinase (JNK) in human prostatic DU-145 cells.
17649957 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17638874 silencing of uPA significantly inhibits prostate tumor growth and the incidence of lung metastasis
17634019 There was a significant positive linear association between ERK1/2 activity and uPA protein expression in laryngeal squamous cell carcinoma.
17611702 the p38(MAPK) signaling pathway is required for optimal LPA-dependent uPA secretion from ovarian cancer cells
17601350 Observational study of gene-disease association. (HuGE Navigator)
17581316 STI571 influence through inducing urokinase-type plasminogen activator and interleukin-8, in which the induction of early growth response-1 expression and extracellular signal-regulated kinase 1/2 phosphorylation might be involved.
17559626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17559626 The urokinase plasminogen activator (BamHI) and plasminogen activator inhibitor type 1 (HindIII) genotypes may serve as useful markers for heritability of bone loss associated with periodontal disease.
17549401 Simultaneous down-regulation of uPAR and uPA induced caspase-8 mediated apoptosis.
17548050 suggest a novel function for tyrosine kinase 2 as an important modulator of the urokinase-directed vascular smooth muscle cell functional behaviour at the place of injury
17545513 stromal fibroblasts play a role in promoting pancreatic cancer metastasis via activation of the uPA-plasminogen-MMP-2 cascade
17532189 pemphigus vulagris-IgG-dependent uPA activation is not related to anti-Dsg3 antibody activity
17523079 Altered expression of PLAU was observed in high-risk soft tssue sarcomas.
17458906 In thyroid cells, plasminogen activators are regulated via MAPK and protein kinase c-beta pathways.
17363771 Observational study of gene-disease association. (HuGE Navigator)
17363771 The PLAU gene codes for this enzyme, and is located on 10q24. This region has demonstrated evidence for linkage in a genome scan for asthma in a sample from northeastern Quebec.
17355798 Both uPA and PAI-1 are up-regulated in epithelial ovarian cancer.
17344041 PLAUR and the somatomedin B region of VTN direct the localization of UPA to focal adhesions in microvessel endothelial cells.
17331567 The association between tissue factor and uPA/suPAR system is significantly related to the presence of cardiovascular disease in hemodialysis patients
17327908 uPA and uPAR are involved in generation of drug-resistant small-cell lung cancer cell phenotype.
17299841 Upregulation of urokinase type plasminogen activator (UroPA) expression during early development of knee osteoarthritis (OA) occurs via MAPK ERK, JNK, and p38 signaling pathways and the PI3K signaling pathway in cultured cells debrided from OA knees.
17299802 The production of matrix metalloproteinases (MMPs), tissue inhibitors of MMPs, and plasminogen activators by gingival fibroblasts stimulated with lipopolysaccharides produced by periodontopathogens, are reported.
17264329 Elevation of plasma uPA and uPAR levels in CaP patients are partly caused by local release from the prostate. Plasma levels of uPA and uPAR are associated with biologically aggressive CaP, disease progression after radical prostatectomy, and metastasis
17258797 PAI-3, but not PAI-1 or uPA, may have a role in breast cancer survival by suppression of tumor invasion through protease inhibition in stroma
17240317 uPA may play a critical role in ligation-induced vessel remodeling
17233842 recombinant kringle domain inhibits the malignant glioma growth by suppression of angiogenesis
17222367 The expression of p-p38 and uPA was negatively correlated to prognosis of breast cancer.
17203182 alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion
17203175 LRP is expressed in colorectal cancer and forms complexes with u-PA and its inhibitor
17192053 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17192053 Urokinase gene 3'-UTR polymorphism associated with prostate cancer.
17187779 This study suggests that ILK serves as a key mediator in TGFbeta1 regulation of uPA/PAI-1 system critical for the invasiveness of human ovarian cancer cells. And ILK is a potential target for cancer therapy.
17174555 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17174555 role for PLAU_1 as an independent genetic risk factor for Alzheimer disease in the Italian population for those subjects who do not have the APOE-epsilon4 allele
17159381 Our results showed that the subcutaneous injection of small interfering RNAs (siRNA) u-PA SKHep1C3 stable transfected cells (pS siRNA u-PA) led to a growth delay in xenograft development.
17083312 The blood concentrations of soluble urokinase-type plasminogen activator (uPAR) and mannan-binding lectin (MBL) are related to the risk of postoperative infectious complications.
17080225 plasmin-mediated apoptosis of VSMC occurs via plasminogen activation by either t-PA or u-PA and is impaired by PAI-1.
17029796 uPA gene regulation by c-phycocyanin (c-pc) is transcriptionally controlled through cAMP mediated PKA pathway.
17013094 autotaxin induces uPA expression via the Gi-PI3K-Akt-NF-kappaB signaling pathway that might be critical for autotaxin-induced tumor cell invasion and metastasis
16967469 Observational study of gene-disease association. (HuGE Navigator)
16967469 distribution of four tagSNPs (rs2227562 in intron 5, rs2227564 in exon 6, rs2227571 in intron 9, and rs4065 in 3'UTR) in the PLAU gene in a large case-control study of Alzheimer's disease
16949925 study shows uPA & uPAR are overexpressed in primary prostate cancer cells & surrounding stromal cells (Gleason score >/=7) & more than 90% lymph node metastases but not in normal prostate, benign prostate hyperplasia or prostatic intraepithelial neoplasia
16908524 the ability of hepsin to efficiently activate pro-uPA suggests that it may initiate plasmin-mediated proteolytic pathways at the tumor/stroma interface that lead to basement membrane disruption and tumor progression
16858643 urokinase-type plasminogen activator (uPA) and its soluble receptor may not have roles in progression of atopic eczema/dermatitis syndrome, as plasma levels of uPA and suPAR are similar in patients at different stages of AEDS and healthy subjects
16855359 review of the expression of the plasminogen activator system in endometriosis
16836076 Methylation of the uPA promoter leads to loss of uPA gene expression in laryngeal squamous cell carcinoma.
16825821 Observational study of gene-disease association. (HuGE Navigator)
16825285 Observational study of gene-disease association. (HuGE Navigator)
16825285 Evidence of a genetic and functional involvement of a common PLAU variant into the pathogenesis of Alzheimer Disease.
16807059 Lipoprotein receptor-related protein -mediated clearance of uPA is one of the mechanisms involved during the control of human thyroid carcinoma cell invasion.
16806969 preliminary crystallographic analysis of amino-terminal fragment
16794252 down-regulation of matriptase expression in THP-1 cells by siRNA reduced the activation of cell-associated pro-uPA and the subsequent rapid initiation of plasminogen activation
16761300 Native electrophoresis and SDS-PAGE showed multiple protein bands corresponding to different forms of the urokinase, which were confirmed by Western blotting and zymography.
16728704 Constitutive uPA primes, and exogenous uPA can activate, airway eosinophil adhesion following segmental allergen challenge and that increased uPA expression may be a mechanism of increased eosinophil infiltration and function in asthma.
16685447 Effects induced by exogeneous addition of domain-specific uPA antibodies and uPA-interacting molecules on proliferation of uPA-suppressed MDA-MB-231 breast cancer cells.
16685436 Intratumoral injections of the plasmid vector expressing siRNA for uPA resulted in regression of pre-established, subcutaneous meningioma tumors.
16632475 incubation of retinal pigment epithelial cells with uPA elicits a time-dependent enhancement of MAPK and phosphatidylinositol 3-kinase activities as well as the transcriptional activation of Bcl-xL anti-apoptotic factor
16604464 In adult alphaMUPA mice (uPA transgenic) the incisor teeth display discoloration and tip fragility, and reduction of the outer enamel as determined by scanning electron microscopy.
16601839 endothelial progenitor cells are characterized by high intrinsic uPA/uPAR-dependent proteolytic potential that could contribute to their invasive and angiogenic behaviour
16547007 urokinase plasminogen receptor domain III controls a functional association with alpha5beta1 integrin and tumor growth
16525631 Results clearly suggest the involvement of the uPA-uPAR system in cell survival and proliferation in addition to their role in tumor progression.
16509805 Observational study of gene-disease association. (HuGE Navigator)
16509805 The T allele of 3' UTR of the urokinase gene may not be associated with a higher risk of stone formation.
16504015 IL-1alpha can induce selective upregulation of alpha6beta1-integrin and uPA/uPAR in pancreatic cancer cells and these changes may modulate the aggressive functions of pancreatic cancer.
16461772 data provide evidence for a novel pathway of fibronectin matrix assembly through the uPAR-dependent sequential activation of Src kinase, EGFR, and beta1 integrin
16459332 the urokinase/PAI-2 complex is a new high affinity ligand for the endocytosis receptor low density lipoprotein receptor-related protein
16456079 crystal structure at 1.9 angstroms of the urokinase receptor complexed with the urokinase amino-terminal fragment and an antibody against the receptor
16385451 Observational study of gene-disease association. (HuGE Navigator)
16267271 Both wild-type (wt) and human cleavage resistant-uPAR are able to mediate uPA-induced migration, are constitutively associated with the EGFR, and associate with alpha3beta1 integrin upon uPA binding
16236890 Induced-sputum innate immune factor levels discriminate inflammatory changes in cystic fibrosis, COPD, and asthma.
16127174 a complex signaling network operating downstream of uPA-uPAR actively advances tumor cell invasion, proliferation, and survival of prostate cancer cells
16113755 Elevated plasma levels in, and therefore a marker for cancers.
16102112 the uPA gene contains a novel 13-bp palindrome that contains the DNA consensus-binding hexamer for RUNX1
16077991 Urokinase-type plasminogen activator is overexpressed in renal cell carcinoma and could function as tumour marker.
16008557 decrease in uPAR mRNA and protein concentrations caused by DNA enzymes significantly suppressed Saos-2 cell invasion as assessed by an in vitro Matrigel assay
15996887 results demonstrate that endogenous HMW uPA inhibits S. aureus growth both directly, by cytolysis, and indirectly, by abrogation of the neutralizing effect of staphylokinase on the bactericidal activities of human neutrophil peptides
15988036 uPA processes recombinant latent platelet-derived growth factor D into the active form.
15944400 the urokinase-type plasminogen activator (uPA) induces, via its specific receptor (uPAR, CD87), upregulated expression of the complement anaphylatoxin C5a receptor
15937335 p53 is induced by urokinase in lung epithelial cells
15927351 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15886816 Epidermal growth factor modulates prostate cancer cell invasiveness by regulating urokinase-type plasminogen activator activity
15885322 The level of urinokinase-type plasminogen activator (u-PA) does not correlate with cerebrospinal fluid to serum albumin ratio, suggesting an unimportant role for uPA in HIV-induced blood-brain-barrier disruption.
15881651 expression and regulation of uPA mRNA. This pathway may regulate uPA-mediated functions of the lung epithelium in the context of inflammation or neoplasia
15880258 Our results suggest that PBK1 is involved in the regulation of uPA expression, which might provide a new clue to further understanding the regulation mechanism of uPA expression.
15868845 Observational study of gene-disease association. (HuGE Navigator)
15854129 sphingosylphosphorylcholine may affect angiogenesis in the wound-healing process via regulation of uPA production
15849510 IGF-I and HGF cooperate to induce migration and invasion of colorectal carcinoma cells, and c-Met and uPA/uPAR are required for IGF-I-mediated migration and invasion.
15831288 basic capacity of separated epithelial and stromal cells from all three types of tissue to release uPA, PAI-1, and suPAR without any paracrine influence, as in vivo
15750768 Observational study of gene-disease association. (HuGE Navigator)
15728176 expression and assembly of uPAR co-receptors in a specific cell type determines the response to uPA
15653692 the G(i)-Ras-Raf-NF-kappaB signaling cascade is responsible for LPA-induced uPA up-regulation in ovarian cancer cells
15646834 VEGF and PAI-1 interact and may have roles in progression of node-negative breast cancer
15629242 sesamol increased the production of uPA and tPA significantly and also up-regulated the mRNA expressions of these proteins.
15616835 Polymorphisms are not associated with late onset Alzheimer's disease.
15615772 Observational study of gene-disease association. (HuGE Navigator)
15558716 Observational study of gene-disease association. (HuGE Navigator)
15515049 uPA mRNA and uPAR mRNA expression were found in 9 and 8 of prostsatic adenocarcinomas, respectively, and in 7 and 6 of benign prostatic hyperplasias.
15494526 Urokinase (uPA) is a potent chemoattractant for basophils that seems to act through exposure of the chemotactic uPA receptor epitope uPAR84-95, which is an endogenous ligand for formyl peptide receptor (FPR)-like 2 (FPRL2) and FPRL1.
15375521 Increased expression of urokinase-type plasminogen activator is associated with transitional cell carcinoma of the human bladder
15371454 participates in endothelial cell migration under regulation of p38 MAPK pathway
15356878 Observational study of gene-disease association. (HuGE Navigator)
15356878 The urokinase gene 3'-UTR "T" allele is associated with oral cancer in humans, and may play a role in oral cancer formation.
15326109 uPA/uPAR ligation anchors the complex to the actin cytoskeleton and is a part of the mechanism responsible for uPA-induced cell migration in fibroblasts.
15262029 Observational study of gene-disease association. (HuGE Navigator)
15262029 Patients with mitral valve prolapse have a higher frequency of PLAU polymorphism among the chinese population in Taiwan.
15243126 Data describe the cyclic variation and distribution of urokinase plasminogen activator (uPA), uPA receptor and plasminogen activator inhibitor 1 (PAI-1) mRNA in normal endometrium.
15231498 Endothelial uPA expression is flow sensitive and differentially regulated by laminar and turbulent shear stress in vitro. This effect may contribute to local nature of atherosclerosis.
15217951 NF-kappaB dysregulation and uPA overexpression have roles in a more aggressive tumor behavior in hepatocellular carcinoma, and IKKbeta plays a critical role in the HBx-activated NF-kappaB signaling pathway
15210852 u-PA down-regulation by RNAi technology decreases the invasive capability of hepatocellular carcinoma cells
15149885 investigated whether the increase of uPA monocyte expression and chemokine releases induced by oxidised low density lipoproteins involved proinflammatory phospholipid products having platelet-activating factor-like activity via the PAFR pathway
15083890 Observational study of gene-disease association. (HuGE Navigator)
15083890 The urokinase gene 3'-UTR "T" allele was associated with rheumatoid arthritis in Chinese patients in Taiwan.
15067375 MMP-13, uPA, and PAI-1 antigen levels were determined in the synovium of patients with osteoarthritis
14983227 urokinase-type plasminogen activator (uPA) and type-1 inhibitor (PAI-I) complex has a role in breast cancer resistance to endocrine therapy independent of steroid hormone receptor status
14983219 uPA and PAI-1 have roles in progression and recurrence of breast cancer [review]
14982725 HIV-1 Vif upregulates the expression of plasminogen activator, urokinase (PLAU) in Vif-expression T cells
14769799 assembly of Plg and uPA on integrin alpha(M)beta(2) regulates Plm activity and, thereby, plays a crucial role in neutrophil-mediated thrombolysis
14747469 suppression of activation of receptor-bound pro-urokinase leads to downregulation of matriptase and inhibition of tumor invasion
14744782 uPA:PAI-1 complex independently predicts the efficacy of adjuvant chemotherapy in patients with primary breast cancer.
14704150 secretion is induced by osteopontin inducing AP-1 through c-Src-dependent epidermal growth factor receptor transactivation in breast cancer cells
14681909 Observational study of gene-disease association. (HuGE Navigator)
14644829 Increased uPa hydrolysis was associated with endometriotic lesion in patients diagnosed with endometriosis.
14597629 uPA is upregulated by TGF-beta1 and PI3 kinase in human tumor cells
14534291 nuclear factor kappaB-mediated secretion of urokinase type plasminogen activator is regulated by p56lck through tyrosine phosphorylation of IkappaBalpha following hypoxia-reoxygenation
14531820 uPA and uPAR are up-regulated during acute renal allograft rejection
14517288 urokinase and urokinase receptor mRNAs are stabilized by HuR linked to its cytoplasmic accumulation induced by activated mitogen-activated protein kinase-activated protein kinase 2
14507113 No significant increases in uPAR were found in pretreatment determinations of patients with advanced small-cell lung cancer or non-small-cell lung cancer.
12960238 predictors of human immunodeficiency virus (HIV) disease progression (review)
12941043 TAFIa inhibited lysis of model thrombi and plasma clots by uPA, scuPA and tPA, which could be partially overcome by plasminogen, consistent with TAFIa exerting its effect through modifying the binding of plasminogen and tPA to fibrin.
12930304 confirm the role of uPA in acantholysis and suggest an involvement of IL-1alpha/TNF-alpha in uPA induction
12926141 Increased expression of u-PA is a feature of bone metastasis in patients with prostate cancer.
12898287 Observational study of gene-disease association. (HuGE Navigator)
12898287 PLAU is a promising new candidate gene for late-onset Alzheimer's disease, with allele C (P141) being a recessive risk allele or allele T (L141) conferring protection.
12883725 the promoter activity of uPA is enhanced in gastric tumor cells by p38 MAPK
12881310 data indicating that the structure of the kringle as well as its interaction with the growth factor domain govern urokinase binding to the urokinase receptor
12832381 The increase in antigenic levels of uPA and MMP-3 in endometrium of women with endometriosis might contribute to the invasive potential of endometrial cells
12773490 Methylation status of uPA promoter regulates prostate cancer invasion and growth.
12771144 first report that osteopontin induces nuclear factor kappaB activity and urokinase secretion by activating phosphatidylinositol 3'-kinase/Akt protein/Ikappab kinase-mediated signaling pathways
12764090 The urokinase-type plasminogen activator (uPA)-plasmin cascade is involved in the activation of astrocyte pro-MMP-2 in glioma-astrocyte coculture that leads to the increased invasiveness of glioma cells in the central nervous system.
12754271 increased expression of urokinase-type plasminogen activator(uPA) may initially lead to degradation of amyloid beta-protein but chronic expression of uPA and plasminogen activation led to loss of cerebrovascular smooth muscle cell attachment
12743986 A high cytosol value of this enyme may be predictive of early relapse in primary breast cancer.
12736046 Plasma uPA levels are greater in those with bladder cancer than in healthy subjects (P <0.001); for patients with bladder cancer, a greater preoperative plasma uPA level was an independent predictor of poor outcome after radical cystectomy.
12719789 evidence that the small GTPases RhoA and Rac1, but not Cdc42, are directly associated with Tyk2 and PI3-K in an uPA/uPAR-dependent fashion and are necessary to mediate the uPA/uPAR-directed migration via the Tyk2/PI3-K signalling complex in human VSMC
12719778 tPA and plasma kallikrein-mediated uPA activation and tPA release contribute to endogenous fibrinolytic or thrombolytic mechanisms.
12708473 The expression of uPA was significantly correlated with depth of gastric tumor invasion, differentiation, lymphatic and vascular invasion.
12704669 uPA regulates uPAR expression in NSCLC at a posttranscriptional level by increasing uPAR-stability through a cellular factor that binds the coding region of uPAR-mRNA
12684636 High expression of Urokinase-type plasminogen activator is associated with melanoma
12642587 Induction of PAI-1 by exposure of lung epithelial cells to uPA is a newly recognized pathway by which PAI-1 could regulate local fibrinolysis in lung inflammation or neoplasia
12576295 PDGF and similar cytokines may be important factors in airway remodeling by redistribution of smooth muscle cells during inflammation and that urokinase may be important in potentiating the response.
12574820 Human/chicken chimeric uPA molecules & point mutants revealed the structural requirements for uPA autoactivation vs zymogen stability. The amino terminal fragment of chicken uPA engineered onto the human uPA molecule induces human uPA autoactivation.
12556966 small, hormone-receptor-positive breast cancers (with a theoretical good prognosis) may carry an elevated risk of nodal involvement if accumulation of uPA-PAI-1 complexes is shown inside their tumour cells by means of immunohistochemistry.
12529357 recombinant kringle domain has anti-angiogenic activity
12477728 Syk, a protein-tyrosine kinase, suppresses the cell motility and nuclear factor kappa B-mediated secretion of this enzyme by inhibiting the phosphatidylinositol 3'-kinase activity in breast cancer cells.
12430175 Observational study of gene-disease association. (HuGE Navigator)
12430175 C/C genotype in exon 6 of uPA gene can be further considered as being related to colorectal cancer progression.
12393547 recognition of uPA by alpha(M)beta(2) allows for formation of a multicontact trimolecular complex, in which a single uPA ligand may bind to both uPAR and alpha(M)beta(2); interaction of uPA with each receptor influences cell adhesion and migration
12377770 promotion of mRNA stability in invasive brease cancer cells by Rac1-MKK3-p38-MAPKAPK2 pathway
12353084 u-PA present on the platelet surface interacts with u-PAR on the endothelial cell and induces u-PA synthesis in the vascular enodthelial cell.
12236587 uPA mrna stability is maintained through shuttling of uPA mRNABp between the nucleus and cytoplasm
12218297 There was a positive correlation between uPA and PAI-1 antigen levels and clinicopathological parameters such as grade (p < 0.001 and p = 0.01, respectively)
12183060 the role of urokinase in the regulation of monocyte/macrophage functions, such as that occurring in inflammatory reactions
12174885 the circluating level and its soluble receptor (suPAR) are not up-regulated by the circulating P105 fraction of the HER-2/neu proto-oncogene: in vivo evidence from patients with advanced NSCLC
12167592 upregulation of PAI-1, uPA, and tPA after long-term LDL exposure seems to be mediated by a delayed PKC activation associated with an increased PA inhibitory activity
12161038 Urokinase plasminogen activator receptor could be associated with BBB disruption and with promotion of CNS invasion by chemotactically active cells, macromolecules, and microbes.
12152683 Characterization of the binding of human urokinase-type plasminogen activator to the asialoglycoprotein receptor of rat liver
12149463 Increased expression of urokinase during atherosclerotic lesion development causes arterial constriction and lumen loss, and accelerates lesion growth.
12115506 expression of uPA and uPAR is associated with the clinical behaviour of bladder neoplasms
12084931 interaction with urokinase receptor mediates inhibitory signal for HIV-1 replication
12041678 Diagnostic significance of measurement of the receptor for urokinase-type plasminogen activator on granulocytes and in plasma from patients with paroxysmal nocturnal hemoglobinuria.
12023847 Structural analysis of the interaction between urokinase-type plasminogen activator and its receptor: a potential target for anti-invasive cancer therapy. Review.
12008951 possible role of fibroblast growth factors in expression of genes of the plasminogen activator system in breast fibroblasts
11956327 Endogenous UPA is not only overexpressed in smooth muscle cells upon stimulation with PDGF/bFGF, but also mediates the mitogenic activity of the growth factors in a catalytic-domain-dependent manner.
11930938 Protease activity, growth factor-like and kringle domains of uPA differentially contribute to activation of p42/p44erk1,2 and p38 MAP-kinases.
11928818 Osteopontin modulates prostate carcinoma invasive capacity through RGD-dependent upregulation of UPA.
11928816 Coculture of monocytes and vascular smooth muscle results in 5-fold increase in UPA expression in monocytes, resulting in VSMC migration.
11928812 In a study of the differential role of UPA and TPA as inducers of fibronectin mRNA, UPA led to an increase of FN mRNA expression in early G1, did not lead to FN assembly in the ECM, induced monomric FN
11928809 Random peptide bacteriophage display used as a probe to identify urokinase receptor binding sites other than the binding site of UPA residues 1-48.
11928807 bFGF up-regulated UPA in both normal and dystrophic myoblasts and weakly upregulated UPA receptor in normal satellite cells.
11928806 Substitution of the two relevant serines with glutamic acid residues impairs the ability of urokinase to mobilize a variety of human and mouse cell lines as well as human primary T lymphocytes.
11906036 significant decresase in PBM uPA activity in HIV infected and immunosuppresed patients independent from the presence of P. carinii lung infections
11880102 Observational study of gene-disease association. (HuGE Navigator)
11876553 Observational study of gene-disease association. (HuGE Navigator)
11858184 TPA & urokinase progressed to maximum levels in late pregnancy, but decreased in labor, favoring a coagulation state despite elevated D-dimer levels suggesting enhanced fibrinolysis.
11827968 Exposure of cryptic domains in the alpha 1-chain of laminin-1 by elastase stimulates macrophages urokinase and matrix metalloproteinase-9 expression.
11805108 Cooperativity between the Ras-ERK and Rho-Rho kinase pathways in urokinase-type plasminogen activator-stimulated cell migration
11751384 Pleiotrophic inhibition of pericellular urokinase-type plasminogen activator system by endogenous tumor suppressive maspin.
11394884 HIV-1 Vif upregulates the expression of plasminogen activator, urokinase (PLAU) in Vif-expression T cells
9143604 HIV-1 Vif upregulates the expression of plasminogen activator, urokinase (PLAU) in Vif-expression T cells
8676469 HIV-1 Vif upregulates the expression of plasminogen activator, urokinase (PLAU) in Vif-expression T cells

AA Sequence

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC      1 - 70
YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK     71 - 140
PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG    141 - 210
GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK    211 - 280
IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY    281 - 350
YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR    351 - 420
SHTKEENGLAL                                                               421 - 431
//

Text Mined References (502)

PMID Year Title
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26846181 2016 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26782341 2016 1,25-Dihydroxyvitamin D3 alleviates salivary adenoid cystic carcinoma progression by suppressing GPX1 expression through the NF-?B pathway.
26707376 2016 Resveratrol inhibits hypoxia-driven ROS-induced invasive and migratory ability of pancreatic cancer cells via suppression of the Hedgehog signaling pathway.
26643086 2016 Impact of guideline-based use of uPA/PAI-1 on patient outcome in intermediate-risk early breast cancer.
26504024 2015 Plasminogen Activation System in Rectal Adenocarcinoma.
26317203 2015 Progression of Osteosarcoma from a Non-Metastatic to a Metastatic Phenotype Is Causally Associated with Activation of an Autocrine and Paracrine uPA Axis.
26166362 2015 Expression and activity analysis of a new fusion protein targeting ovarian cancer cells.
26050228 2015 Macrophages of M1 phenotype have properties that influence lung cancer cell progression.
26033187 2015 Urokinase-type plasminogen activator resulting from endometrial carcinogenesis enhances tumor invasion and correlates with poor outcome of endometrial carcinoma patients.
26027394 [Expression of plasminogen activator system components in the gastric mucosa in portal hypertensive gastropathy].
25993872 2015 [Changes in markers of proliferation, neoangiogenesis and plasminogen activation system in rectal cancer tissue].
25979345 2015 Porphyromonas gingivalis-derived RgpA-Kgp Complex Activates the Macrophage Urokinase Plasminogen Activator System: IMPLICATIONS FOR PERIODONTITIS.
25962429 2015 FOXM1-mediated downregulation of uPA and MMP9 by 3,3'-diindolylmethane inhibits migration and invasion of human colorectal cancer cells.
25744057 2015 Distinctive binding modes and inhibitory mechanisms of two peptidic inhibitors of urokinase-type plasminogen activator with isomeric P1 residues.
25706093 2015 Involvement of urokinase in cigarette smoke extract-induced epithelial-mesenchymal transition in human small airway epithelial cells.
25641046 2016 Urokinase is a negative modulator of Egf-dependent proliferation and motility in the two breast cancer cell lines MCF-7 and MDA-MB-231.
25555911 2015 Proteolytic regulation of epithelial sodium channels by urokinase plasminogen activator: cutting edge and cleavage sites.
25554417 2015 MiR-10a and miR-181c regulate collagen type I generation in hypertrophic scars by targeting PAI-1 and uPA.
25544710 2015 Overexpression of ETV4 is associated with poor prognosis in prostate cancer: involvement of uPA/uPAR and MMPs.
25433194 2015 Urokinase type plasminogen activator mediates Interleukin-17-induced peripheral blood mesenchymal stem cell motility and transendothelial migration.
25394558 2015 Expression and anticancer activity analysis of recombinant human uPA1?43-melittin.
25371209 2014 MUC1 protein induces urokinase-type plasminogen activator (uPA) by forming a complex with NF-?B p65 transcription factor and binding to the uPA promoter, leading to enhanced invasiveness of cancer cells.
25323935 2015 Further evaluation of uPA and PAI-1 as biomarkers for prostatic diseases.
25244504 2014 Urokinase-type plasminogen activator (uPA) stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2.
25215905 2014 miR-193b directly targets STMN1 and uPA genes and suppresses tumor growth and metastasis in pancreatic cancer.
25168896 2014 SLURP-1 modulates corneal homeostasis by serving as a soluble scavenger of urokinase-type plasminogen activator.
25082749 2014 Protease-mediated human smooth muscle cell proliferation by urokinase requires epidermal growth factor receptor transactivation by triple membrane signaling.
24952395 2014 The PLAU P141L single nucleotide polymorphism is associated with collateral circulation in patients with coronary artery disease.
24877154 2014 Association of tissue mRNA and serum antigen levels of members of the urokinase-type plasminogen activator system with clinical and prognostic parameters in prostate cancer.
24822208 2014 Urokinase gene 3'-UTR T/C polymorphism is associated with malignancy and ESRD in idiopathic membranous nephropathy.
24807734 2014 Augmented expression of urokinase plasminogen activator and extracellular matrix proteins associates with multiple myeloma progression.
24756697 2014 Polyserase-1/TMPRSS9 induces pro-tumor effects in pancreatic cancer cells by activation of pro-uPA.
24702774 2014 Interleukin-33 induces urokinase in human endothelial cells--possible impact on angiogenesis.
24648800 2014 Urokinase, urokinase receptor, and plasminogen activator inhibitor-1 expression on podocytes in immunoglobulin A glomerulonephritis.
24626561 2014 IL-1?-stimulated urokinase plasminogen activator expression through NF-?B in gastric cancer after HGF treatment.
24616477 2014 Urokinase plasminogen activator is a central regulator of macrophage three-dimensional invasion, matrix degradation, and adhesion.
24610082 2014 Transforming growth factor-beta signaling leads to uPA/PAI-1 activation and metastasis: a study on human breast cancer tissues.
24549574 2014 Involvement of urokinase-type plasminogen activator system in cancer: an overview.
24529115 2014 Urokinase-type plasminogen activator (uPA) decreases hepatic SR-BI expression and impairs HDL-mediated reverse cholesterol transport.
24481457 2014 Plasminogen activator urokinase expression reveals TRAIL responsiveness and supports fractional survival of cancer cells.
24479343 [Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines].
24434139 2014 TMPRSS4 induces cancer cell invasion through pro-uPA processing.
24340014 2013 Oncogenic K-Ras and loss of Smad4 mediate invasion by activating an EGFR/NF-?B Axis that induces expression of MMP9 and uPA in human pancreas progenitor cells.
24304137 2013 uPAR, IL-33, and ST2 values as a predictor of subclinical chorioamnionitis in preterm premature rupture of membranes.
24217605 2014 Role of uPA/uPAR in the modulation of angiogenesis.
24111848 2013 Plasminogen-stimulated airway smooth muscle cell proliferation is mediated by urokinase and annexin A2, involving plasmin-activated cell signalling.
24057344 2014 Plasma urokinase antigen and C-reactive protein predict angina recurrence after coronary angioplasty.
24023701 2013 Involvement of the serine protease inhibitor, SERPINE2, and the urokinase plasminogen activator in cumulus expansion and oocyte maturation.
23985164 2013 Clinical significance of the uPA system in gastric cancer with peritoneal metastasis.
23978400 2014 TMPRSS4 upregulates uPA gene expression through JNK signaling activation to induce cancer cell invasion.
23900236 2013 Modulation of u-PA, MMPs and their inhibitors by a novel nutrient mixture in pediatric human sarcoma cell lines.
23898067 2013 Keratinocytes and head and neck squamous cell carcinoma cells regulate urokinase-type plasminogen activator and plasminogen activator inhibitor-1 in fibroblasts.
23897640 2014 Common genetic variants in the plasminogen activation pathway are not associated with multiple sclerosis.
23864708 2013 Multifunctional roles of urokinase plasminogen activator (uPA) in cancer stemness and chemoresistance of pancreatic cancer.
23848154 2013 Structural investigations of recombinant urokinase growth factor-like domain.
23813610 2013 Meta-analysis of the association between urokinase-plasminogen activator gene rs2227564 polymorphism and Alzheimer's disease.
23812296 2013 UPA promotes lipid-loaded vascular smooth muscle cell migration through LRP-1.
23661254 2013 Modulation of u-PA, MMPs and their inhibitors by a novel nutrient mixture in adult human sarcoma cell lines.
23628797 2013 Significant association of urokinase plasminogen activator Pro141Leu with serum lipid profiles in a Japanese population.
23621237 2013 Single nucleotide polymorphisms in the u-PA gene are related to susceptibility to oral tongue squamous cell carcinoma in the Northern Chinese Han population.
23615713 2013 Stromal cell-derived factor-1 (SDF-1) enhances cells invasion by ?v?6 integrin-mediated signaling in ovarian cancer.
23597113 2013 Shear stress modulates macrophage-induced urokinase plasminogen activator expression in human chondrocytes.
23536772 2013 Urokinase plasminogen activator induces pro-fibrotic/m2 phenotype in murine cardiac macrophages.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532423 2013 Association of calcium urolithiasis with urokinase P141L and 3'-UTR C>T polymorphisms in a Japanese population.
23441133 2013 Radiation-induced hypomethylation triggers urokinase plasminogen activator transcription in meningioma cells.
23392805 2013 TRAIL-induced expression of uPA and IL-8 strongly enhanced by overexpression of TRAF2 and Bcl-xL in pancreatic ductal adenocarcinoma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23350235 The influence of opioid peptides on matrix metalloproteinase-9 and urokinase plasminogen activator expression in three cancer cell lines.
23322578 2013 Ultraviolet-A irradiation upregulated urokinase-type plasminogen activator in pterygium fibroblasts through ERK and JNK pathways.
23169000 2012 PLAU inferred from a correlation network is critical for suppressor function of regulatory T cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23064953 2012 Novel aspects of urokinase function in the injured lung: role of ?2-macroglobulin.
23059760 2013 uPA and MMP-2 were involved in self-assembled network formation in a two dimensional co-culture model of bone marrow stromal cells and endothelial cells.
22994764 2012 Relationships of uPA and VEGF expression in esophageal cancer and microvascular density with tumorous invasion and metastasis.
22986534 2013 Interleukin enhancer-binding factor 3 promotes breast tumor progression by regulating sustained urokinase-type plasminogen activator expression.
22927998 2012 Gelsolin induces colorectal tumor cell invasion via modulation of the urokinase-type plasminogen activator cascade.
22906080 2012 Aggregated low-density lipoprotein induce impairment of the cytoskeleton dynamics through urokinase-type plasminogen activator/urokinase-type plasminogen activator receptor in human vascular smooth muscle cell.
22797919 2012 PKD2 and PKD3 promote prostate cancer cell invasion by modulating NF-?B- and HDAC1-mediated expression and activation of uPA.
22797075 2013 CFTR suppresses tumor progression through miR-193b targeting urokinase plasminogen activator (uPA) in prostate cancer.
22707264 2012 Lycopene inhibits angiogenesis both in vitro and in vivo by inhibiting MMP-2/uPA system through VEGFR2-mediated PI3K-Akt and ERK/p38 signaling pathways.
22702340 2012 In papillary thyroid carcinoma BRAFV600E is associated with increased expression of the urokinase plasminogen activator and its cognate receptor, but not with disease-free interval.
22684547 2012 Sphingosine kinase 1 enhances colon cancer cell proliferation and invasion by upregulating the production of MMP-2/9 and uPA via MAPK pathways.
22575880 2012 Urokinase requires NAD(P)H oxidase to transactivate the epidermal growth factor receptor.
22470492 2012 Degradation of internalized ?v?5 integrin is controlled by uPAR bound uPA: effect on ?1 integrin activity and ?-SMA stress fiber assembly.
22467324 2012 Expression of urokinase-type plasminogen activator (uPA), its receptor (uPAR), and inhibitor (PAI-1) in human breast carcinomas and their clinical relevance.
22354580 2012 Genetic polymorphism of urokinase-type plasminogen activator is interacting with plasminogen activator inhibitor-1 to raise risk of cervical neoplasia.
22294827 2012 High level of urokinase plasminogen activator contributes to cholangiocarcinoma invasion and metastasis.
22291969 2012 Inhibition of histone deacetylase activity in human endometrial stromal cells promotes extracellular matrix remodelling and limits embryo invasion.
22280367 2012 Fibulin-5 binds urokinase-type plasminogen activator and mediates urokinase-stimulated ?1-integrin-dependent cell migration.
22199285 2011 Resveratrol reduces TNF-?-induced U373MG human glioma cell invasion through regulating NF-?B activation and uPA/uPAR expression.
22177802 2012 uPA and uPAR shRNA inhibit angiogenesis via enhanced secretion of SVEGFR1 independent of GM-CSF but dependent on TIMP-1 in endothelial and glioblastoma cells.
22166006 2012 Regulation of urokinase expression at the posttranscription level by lung epithelial cells.
22102275 2011 Quebec platelet disorder: update on pathogenesis, diagnosis, and treatment.
22004682 2011 Specific knockdown of uPA/uPAR attenuates invasion in glioblastoma cells and xenografts by inhibition of cleavage and trafficking of Notch -1 receptor.
21989445 Prognostic significance of urokinase-type plasminogen activator (uPA) and plasminogen activator inhibitor (PAI-1) in patients with primary invasive ductal breast carcinoma - a 7.5-year follow-up study.
21965736 2011 Oncostatin M and IL-6 induce u-PA and VEGF in prostate cancer cells and correlate in vivo.
21913037 2012 Implication of MMP-9 and urokinase plasminogen activator (uPA) in the activation of pro-matrix metalloproteinase (MMP)-13.
21858104 2011 Anti-angiogenic and anti-inflammatory properties of kahweol, a coffee diterpene.
21833477 2011 Expression of urokinase-type plasminogen activator/urokinase-type plasminogen activator receptor and maspin in oral squamous cell carcinoma: Association with mode of invasion and clinicopathological factors.
21819230 2012 Genetic variants in fibrinolytic system-related genes in infertile women with and without endometriosis.
21798735 2012 SMAD3 is essential for transforming growth factor-?1-induced urokinase type plasminogen activator expression and migration in transformed keratinocytes.
21761413 2011 Genetic polymorphism of the plasminogen activator inhibitor-1 is associated with an increased risk of endometrial cancer.
21744990 2011 Clinical significance of the plasminogen activator system in relation to grade of tumor and treatment response in colorectal carcinoma patients.
21711960 The expression of fibrinolytic components in chronic paranasal sinus disease.
21709151 2011 Macrophage-specific expression of urokinase-type plasminogen activator promotes skeletal muscle regeneration.
21670079 2011 Inhibition of miR-193a expression by Max and RXR? activates K-Ras and PLAU to mediate distinct aspects of cellular transformation.
21669207 2011 Activation of the zymogen to urokinase-type plasminogen activator is associated with increased interdomain flexibility.
21627387 2011 A C to T polymorphism of urokinase plasminogen activator (P141L) is associated with Helicobacter pylori infection.
21574189 2011 Silibinin inhibits the invasion and migration of renal carcinoma 786-O cells in vitro, inhibits the growth of xenografts in vivo and enhances chemosensitivity to 5-fluorouracil and paclitaxel.
21567400 2012 Stromal cell-derived factor-1/CXC receptor 4 and ?1 integrin interaction regulates urokinase-type plasminogen activator expression in human colorectal cancer cells.
21426933 2011 Suppression of uPA and uPAR blocks radiation-induced MCP-1 mediated recruitment of endothelial cells in meningioma.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21316840 2011 Molecular competition between plasminogen activator inhibitors type -1 and -2 for urokinase: Implications for cellular proteolysis and adhesion in cancer.
21242962 2011 Human papillomavirus type 16 E6 induces cervical cancer cell migration through the p53/microRNA-23b/urokinase-type plasminogen activator pathway.
21219832 2011 [Expression and clinical relevance of uPA and ET-1 in non-small cell lung cancer].
21199867 2011 Structural basis for recognition of urokinase-type plasminogen activator by plasminogen activator inhibitor-1.
21181094 2011 Downregulation of uPA/uPAR inhibits intermittent hypoxia-induced epithelial-mesenchymal transition (EMT) in DAOY and D283 medulloblastoma cells.
21174062 2011 Down-regulation of osteopontin inhibits metastasis of hepatocellular carcinoma cells via a mechanism involving MMP-2 and uPA.
21106716 2011 High expression of the urokinase plasminogen activator and its cognate receptor associates with advanced stages and reduced disease-free interval in papillary thyroid carcinoma.
21104439 2011 Osteopontin promotes hepatocellular carcinoma invasion by up-regulating MMP-2 and uPA expression.
21076612 2010 GATA6 promotes colon cancer cell invasion by regulating urokinase plasminogen activator gene expression.
21071923 2010 Curcumin facilitates fibrinolysis and cellular migration during wound healing by modulating urokinase plasminogen activator expression.
20937265 2011 Association of polymorphisms in the genes of the urokinase plasminogen activation system with susceptibility to and severity of non-small cell lung cancer.
20931209 2011 The plasminogen activator inhibitor system in colon cancer cell lines is influenced by the CO2 pneumoperitoneum.
20805979 2010 Suppression of uPA and uPAR attenuates angiogenin mediated angiogenesis in endothelial and glioblastoma cell lines.
20740581 2010 Tumour budding, uPA and PAI-1 are associated with aggressive behaviour in colon cancer.
20708412 Immunohistochemical properties in the patients with Buerger's disease--possible role of plasminogen activator inhibitor-1 for preservation of vessel wall architecture.
20693403 2011 Plasminogen activation by airway smooth muscle is regulated by type I collagen.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20651370 2010 Insulin-like growth factors II exon 9 and E-cadherin-Pml I but not myeloperoxidase promoter-463, urokinase-ApaL I nor xeroderma pigmentosum polymorphisms are associated with higher susceptibility to leiomyoma.
20645833 2010 Effect of bFGF on invasion of ovarian cancer cells through the regulation of Ets-1 and urokinase-type plasminogen activator.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20584616 2010 Cerebrospinal fluid u-plasminogen activator and matrix metalloproteinase-9 levels in human eosinophilic meningitis associated with angiostrongyliasis.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20518747 2010 Association of putative functional variants in the PLAU gene and the PLAUR gene with myocardial infarction.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20445443 2010 Mechanism of the synergistic effect between oversulfated chondroitin-6-sulfate and lysine or 6-aminohexanoic acid in enhancing the in-vitro activation of glutamic plasminogen by tissue plasminogen activator or urokinase.
20403162 2010 Increased expression of urokinase plasminogen activator and its cognate receptor in human seminomas.
20369484 2010 [Changes of plasma uPA and TGF-beta1 in patients with preeclampsia].
20337595 2010 Activation of human pro-urokinase by unrelated proteases secreted by Pseudomonas aeruginosa.
20204407 2010 Comparison of microarray-based RNA expression with ELISA-based protein determination of HER2, uPA and PAI-1 in tumour tissue of patients with breast cancer and relation to outcome.
20198323 2010 Radiation-inducible silencing of uPA and uPAR in vitro and in vivo in meningioma.
20097831 2010 Regulation of airway contractility by plasminogen activators through N-methyl-D-aspartate receptor-1.
20052287 2010 Poised transcription factories prime silent uPA gene prior to activation.
20051950 2010 Co-detection of members of the urokinase plasminogen activator system in tumour tissue and serum correlates with a poor prognosis for soft-tissue sarcoma patients.
20043086 2010 ErbB2-enhanced invasiveness of H-Ras MCF10A breast cells requires MMP-13 and uPA upregulation via p38 MAPK signaling.
20039121 2010 High levels of uPA and PAI-1 predict a good response to anthracyclines.
20036101 2010 In vivo suppression of vein graft disease by nonviral, electroporation-mediated, gene transfer of tissue inhibitor of metalloproteinase-1 linked to the amino terminal fragment of urokinase (TIMP-1.ATF), a cell-surface directed matrix metalloproteinase inhibitor.
20015050 2010 Pericellular activation of hepatocyte growth factor by the transmembrane serine proteases matriptase and hepsin, but not by the membrane-associated protease uPA.
20007542 2010 Persons with Quebec platelet disorder have a tandem duplication of PLAU, the urokinase plasminogen activator gene.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903858 2009 De-N-acetyl GM3 promotes melanoma cell migration and invasion through urokinase plasminogen activator receptor signaling-dependent MMP-2 activation.
19889475 2011 No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
19845941 2009 Cytokeratin 8 ectoplasmic domain binds urokinase-type plasminogen activator to breast tumor cells and modulates their adhesion, growth and invasiveness.
19826838 2010 Urokinase expression in course of benign and malignant mammary lesions: comparison between nodular and healthy tissues.
19776673 2009 Differential prognostic impact of uPA and PAI-1 in colon and rectal cancer.
19740518 2010 Urokinase-type plasminogen activator is a marker of aggressive phenotype and an independent prognostic factor in mismatch repair-proficient colorectal cancer.
19735728 2009 Integrin alpha(v)beta(3), metalloproteinases, and sphingomyelinase-2 mediate urokinase mitogenic effect.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19729488 2009 Comparative analysis of metastasis variants derived from human prostate carcinoma cells: roles in intravasation of VEGF-mediated angiogenesis and uPA-mediated invasion.
19723042 2009 Expression of MMP-2, MMP-9, and urokinase-type plasminogen activator in cervical intraepithelial neoplasia.
19703758 2009 Monocyte urokinase-type plasminogen activator up-regulation reduces thrombus size in a model of venous thrombosis.
19701247 2009 Downregulation of miR-193b contributes to enhance urokinase-type plasminogen activator (uPA) expression and tumor progression and invasion in human breast cancer.
19693769 2009 Down-regulation of uPA and uPAR by 3,3'-diindolylmethane contributes to the inhibition of cell growth and migration of breast cancer cells.
19616049 2009 Soluble urokinase receptor conjugated to carrier red blood cells binds latent pro-urokinase and alters its functional profile.
19546228 2009 Reversibility of epithelial-mesenchymal transition (EMT) induced in breast cancer cells by activation of urokinase receptor-dependent cell signaling.
19536843 2009 Two distinct expression patterns of urokinase, urokinase receptor and plasminogen activator inhibitor-1 in colon cancer liver metastases.
19526059 2009 Polymorphic variation of genes in the fibrinolytic system and the risk of ovarian cancer.
19513384 2008 Analysis of NM23 protein and components of plasminogen activation system in tumors of patients with stomach cancer with consideration for disease clinical picture and morphology.
19497963 2009 Urokinase activates macrophage PON2 gene transcription via the PI3K/ROS/MEK/SREBP-2 signalling cascade mediated by the PDGFR-beta.
19490101 2009 MicroRNA-23b mediates urokinase and c-met downmodulation and a decreased migration of human hepatocellular carcinoma cells.
19475533 2009 Tumor stroma is the predominant uPA-, uPAR-, PAI-1-expressing tissue in human breast cancer: prognostic impact.
19436306 2009 Bacterial endotoxin enhances colorectal cancer cell adhesion and invasion through TLR-4 and NF-kappaB-dependent activation of the urokinase plasminogen activator system.
19403319 2009 Ab initio molecular orbital calculations on specific interactions between urokinase-type plasminogen activator and its receptor.
19394555 2009 Cell migration in response to the amino-terminal fragment of urokinase requires epidermal growth factor receptor activation through an ADAM-mediated mechanism.
19298527 2009 Survivin is an essential mediator of arthritis interacting with urokinase signalling.
19272641 2009 The urokinase plasminogen activator (uPA) system in uterine natural killer cells in the placental bed during early pregnancy.
19232508 2009 Enhanced levels of urokinase plasminogen activator and its soluble receptor in common variable immunodeficiency.
19177205 2009 Proteomic identification of LASP-1 down-regulation after RNAi urokinase silencing in human hepatocellular carcinoma cells.
19176991 2008 The plasminogen activator system and cancer.
19157142 2008 [The expression and significance of urokinase-type plasminogen activator and its receptor in squamous cell carcinoma of hypopharynx].
19147749 2009 Targeted knockdown of Notch1 inhibits invasion of human prostate cancer cells concomitant with inhibition of matrix metalloproteinase-9 and urokinase plasminogen activator.
19133257 2009 The tyrosine phosphatase SHP-2 controls urokinase-dependent signaling and functions in human vascular smooth muscle cells.
19132247 2008 Recombinant production of a hybrid plasminogen activator composed of surfactant protein B and low-molecular-weight urokinase.
19123477 2009 Two distinct expression patterns of urokinase, urokinase receptor and plasminogen activator inhibitor-1 in colon cancer liver metastases.
19117638 2009 Plasminogen activator inhibitor variants PAI-1 A15T and PAI-2 S413C influence lung cancer prognosis.
19115132 2009 Expression of the urokinase plasminogen activator receptor (uPAR) and its ligand (uPA) in brain tissues of human immunodeficiency virus patients with opportunistic cerebral diseases.
19102416 Clinicopathological significance of urokinase-type plasminogen activator genotypes in gastric cancer.
19101688 2009 Co-expression of urokinase with haptoglobin in human carcinomas.
19097143 2009 IL-1 beta induces urokinase-plasminogen activator expression and cell migration through PKC alpha, JNK1/2, and NF-kappaB in A549 cells.
19088796 2008 Effect of oxidative stress on the expression of t-PA, u-PA, u-PAR, and PAI-1 in endothelial cells.
19029443 2009 Increased expression of urokinase plasminogen activator in Quebec platelet disorder is linked to megakaryocyte differentiation.
19020551 2009 AP-1-controlled hepatocyte growth factor activation promotes keratinocyte migration via CEACAM1 and urokinase plasminogen activator/urokinase plasminogen receptor.
18997817 2009 The uPA/uPAR system regulates the bioavailability of PDGF-DD: implications for tumour growth.
18988861 2009 Quebec platelet disorder is linked to the urokinase plasminogen activator gene (PLAU) and increases expression of the linked allele in megakaryocytes.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18954937 2008 Increased soluble urokinase plasminogen activator receptor (suPAR) is associated with thrombosis and inhibition of plasmin generation in paroxysmal nocturnal hemoglobinuria (PNH) patients.
18949356 2008 uPA/uPAR downregulation inhibits radiation-induced migration, invasion and angiogenesis in IOMM-Lee meningioma cells and decreases tumor growth in vivo.
18940913 2008 Signaling through urokinase and urokinase receptor in lung cancer cells requires interactions with beta1 integrins.
18835034 2008 Plasminogen activator inhibitor-1 protects endothelial cells from FasL-mediated apoptosis.
18824154 2008 Mapping the putative binding site for uPA protein in Esophageal Cancer-Related Gene 2 by heteronuclear NMR method.
18788551 2008 [Expression of urokinase-type plasminogen activator and urokinase-type plasminogen activator receptor in synovial fluid of patients with temporomandibular disorders].
18714186 2008 Serum cathepsin B and plasma urokinase-type plasminogen activator levels in gastrointestinal tract cancers.
18691743 2009 Evaluation of plasma urokinase-type plasminogen activator and urokinase-type plasminogen-activator receptor in patients with acute and chronic hepatitis B.
18600101 2008 Evaluation of urokinase plasminogen activator in urine from individuals with Quebec platelet disorder.
18599586 2008 Increased expression of the urokinase plasminogen activator system by Helicobacter pylori in gastric epithelial cells.
18570153 FAP-alpha and uPA show different expression patterns in premalignant and malignant esophageal lesions.
18519237 2008 Plasminogen activator inhibitor-1 (PAI-1) and urokinase plasminogen activator (uPA) in sputum of allergic asthma patients.
18511987 2008 Antigen levels of urokinase-type plasminogen activator receptor and its gene polymorphism related to microvessel density in colorectal cancer.
18491991 2008 The role of urokinase in idiopathic pulmonary fibrosis and implication for therapy.
18478929 2007 [Epidermal growth factor-mediated NF-kappaB activation promotes uPA expression and invasiveness in pancreatic cancer cells].
18466392 2008 The effects of cyclooxygenase2-prostaglandinE2 pathway on Helicobacter pylori-induced urokinase-type plasminogen activator system in the gastric cancer cells.
18439850 Expression of urokinase-type plasminogen activator system in prostate cancer: correlation with clinicopathological outcomes in patients undergoing radical prostatectomy.
18436804 2008 Urokinase plasminogen activator upregulates paraoxonase 2 expression in macrophages via an NADPH oxidase-dependent mechanism.
18390474 2008 Urokinase expression by tumor suppressor protein p53: a novel role in mRNA turnover.
18376415 2008 Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes.
18376307 2008 Prognostic significance of growth factors and the urokinase-type plasminogen activator system in pancreatic ductal adenocarcinoma.
18362146 2008 A composite role of vitronectin and urokinase in the modulation of cell morphology upon expression of the urokinase receptor.
18355442 2008 Urokinase directly activates matrix metalloproteinases-9: a potential role in glioblastoma invasion.
18337556 2008 Nuclear translocation of urokinase-type plasminogen activator.
18331597 2008 Staphylokinase reduces plasmin formation by endogenous plasminogen activators.
18321763 2008 Thrombospondin-1 enhances human thyroid carcinoma cell invasion through urokinase activity.
18257282 2007 [The analysis of plasma Urokinase-type plasminogen activator and Urokinase-type plasminogen activator receptor which unknown factor nosebleed patients].
18240004 2008 Association of urokinase gene 3'-UTR T/C polymorphism with calcium oxalate urolithiasis in children.
18239069 2008 Glucocorticoid (GC)-mediated down-regulation of urokinase plasminogen activator expression via the serum and GC regulated kinase-1/forkhead box O3a pathway.
18237545 2008 Serum amyloid A enhances plasminogen activation: implication for a role in colon cancer.
18208536 2008 Common genetic variants associated with plasma fibrin D-dimer concentration in older European- and African-American adults.
18202522 2007 IL-1beta stimulates urokinase-type plasminogen activator expression and secretion in human dental pulp cells.
18196271 2008 Influence of preoperative core biopsies on uPA/PAI-1 expression in breast cancer tissue.
18193533 2007 Intracellular localization of protein C inhibitor (PCI) and urinary plasminogen activator in renal tubular epithelial cells from humans and human PCI gene transgenic mice.
18177545 2008 Protein kinase C synergistically stimulates tumor necrosis factor-alpha-induced secretion of urokinase-type plasminogen activator in human dental pulp cells.
18076013 2008 Multimarker phenotype predicts adverse survival in patients with lymph node-negative colorectal cancer.
18053985 2008 Interactions of myeloma cells with osteoclasts promote tumour expansion and bone degradation through activation of a complex signalling network and upregulation of cathepsin K, matrix metalloproteinases (MMPs) and urokinase plasminogen activator (uPA).
18048089 2008 The urokinase-type plasminogen activator/its soluble receptor system is independently related to carotid atherosclerosis and associated with CC-chemokines in uraemic patients.
17994220 2008 Association between urokinase haplotypes and outcome from infection-associated acute lung injury.
17986506 2008 PAI and TPA gene polymorphisms in multiple sclerosis.
17974965 2007 Protein kinase C-alpha-mediated regulation of low-density lipoprotein receptor related protein and urokinase increases astrocytoma invasion.
17949787 2008 Expression of matrix metalloproteinases-1, -2, and -9; tissue inhibitors of matrix metalloproteinases-1 and -2; cathepsin B; urokinase plasminogen activator; and plasminogen activator inhibitor, type I in skull base chordoma.
17934860 2008 Mcp-1, eNOS, tPA and PAI-1 gene polymorphism and correlation of genotypes and phenotypes in hepatopulmonary syndrome.
17923479 2007 Inhibition of histone deacetylase activity promotes invasion of human cancer cells through activation of urokinase plasminogen activator.
17921261 2007 Detailed technical analysis of urine RNA-based tumor diagnostics reveals ETS2/urokinase plasminogen activator to be a novel marker for bladder cancer.
17880283 2007 Urinary-type plasminogen activator (uPA) and its receptor (uPAR) in squamous cell carcinoma of the oral cavity.
17877801 2007 Common TNF-alpha, IL-1 beta, PAI-1, uPA, CD14 and TLR4 polymorphisms are not associated with disease severity or outcome from Gram negative sepsis.
17709546 2007 Urokinase-type plasminogen activator stimulation of monocyte matrix metalloproteinase-1 production is mediated by plasmin-dependent signaling through annexin A2 and inhibited by inactive plasmin.
17681345 2007 Urokinase plasminogen activator (uPA) stimulates cholesterol biosynthesis in macrophages through activation of SREBP-1 in a PI3-kinase and MEK-dependent manner.
17661167 2007 4G/5G polymorphism of PAI-1 gene and Alu-repeat I/D polymorphism of TPA gene in Turkish patients with polycystic ovary syndrome.
17657740 2007 RNAi-mediated downregulation of urokinase plasminogen activator receptor and matrix metalloprotease-9 in human breast cancer cells results in decreased tumor invasion, angiogenesis and growth.
17654528 2008 c-jun-NH2JNK mediates invasive potential and EGFR activation by regulating the expression of HB-EGF in a urokinase-stimulated pathway.
17649957 Gene polymorphisms of fibrinolytic enzymes in coal workers' pneumoconiosis.
17638874 2007 Small interfering RNA directed reversal of urokinase plasminogen activator demethylation inhibits prostate tumor growth and metastasis.
17634019 2007 [The relationship between the activation of ERK and the up-regulation of uPA in laryngeal squamous cell carcinoma].
17611702 2007 Lysophosphatidic acid induction of urokinase plasminogen activator secretion requires activation of the p38MAPK pathway.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17581316 2007 Induction of urokinase-type plasminogen activator, interleukin-8 and early growth response-1 by STI571 through activating mitogen activated protein kinase in human small cell lung cancer cells.
17559626 2007 Association of gene polymorphisms for plasminogen activators with alveolar bone loss.
17549401 2007 Down-regulation of uPAR and uPA activates caspase-mediated apoptosis and inhibits the PI3K/AKT pathway.
17548050 2007 Tyk2 mediates effects of urokinase on human vascular smooth muscle cell growth.
17545513 2007 Interaction between cancer cells and stromal fibroblasts is required for activation of the uPAR-uPA-MMP-2 cascade in pancreatic cancer metastasis.
17532189 2007 No activation of urokinase plasminogen activator by anti-desmoglein 3 monoclonal IgG antibodies in cultured human keratinocytes.
17523079 2007 Altered expression of urokinase-type plasminogen activator and plasminogen activator inhibitor in high-risk soft tissue sarcomas.
17458906 2007 Regulation of plasminogen activators in human thyroid follicular cells and their relationship to differentiated function.
17363771 2007 Association of urokinase-type plasminogen activator with asthma and atopy.
17355798 2007 [Expression and clinical significance of uPA and PAI-1 in epithelial ovarian cancer].
17344041 2007 The uPA receptor and the somatomedin B region of vitronectin direct the localization of uPA to focal adhesions in microvessel endothelial cells.
17331567 2007 Tissue factor and urokinase-type plasminogen activator system are related to the presence of cardiovascular disease in hemodialysis patients.
17327908 2007 Identification of uPAR-positive chemoresistant cells in small cell lung cancer.
17299841 2007 Upregulation of urokinase-type plasminogen activator and inhibitor and gelatinase expression via 3 mitogen-activated protein kinases and PI3K pathways during the early development of osteoarthritis.
17299802 2007 Actinobacillus actinomycetemcomitans lipopolysaccharide regulates matrix metalloproteinase, tissue inhibitors of matrix metalloproteinase, and plasminogen activator production by human gingival fibroblasts: a potential role in connective tissue destruction.
17264329 2007 Association of the circulating levels of the urokinase system of plasminogen activation with the presence of prostate cancer and invasion, progression, and metastasis.
17258797 2007 Expression of plasminogen activator inhibitors type 1 and type 3 and urokinase plasminogen activator protein and mRNA in breast cancer.
17240317 2007 Urokinase-type plasminogen activator deficiency (uPA-KO) prevented carotid artery ligation-induced vascular remodeling in mice.
17233842 2007 The recombinant kringle domain of urokinase plasminogen activator inhibits in vivo malignant glioma growth.
17222367 2007 [Correlation of p38 mitogen-activated protein kinase signal transduction pathway to uPA expression in breast cancer].
17203182 2007 Induction of alpha2-antiplasmin inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion.
17203175 2007 The expression of low density lipoprotein receptor-related protein in colorectal carcinoma.
17192053 2005 Is urokinase gene 3'-UTR polymorphism associated with prostate cancer?
17187779 2007 Critical involvement of ILK in TGFbeta1-stimulated invasion/migration of human ovarian cancer cells is associated with urokinase plasminogen activator system.
17174555 2007 The urokinase-type plasminogen activator polymorphism PLAU_1 is a risk factor for APOE-epsilon4 non-carriers in the Italian Alzheimer's disease population and does not affect the plasma Abeta(1-42) level.
17159381 2007 RNA interference against urokinase in hepatocellular carcinoma xenografts in nude mice.
17083312 2006 Preoperative concentrations of suPAR and MBL proteins are associated with the development of pneumonia after elective surgery for colorectal cancer.
17080225 2006 Plasminogen activator inhibitor-1 impairs plasminogen activation-mediated vascular smooth muscle cell apoptosis.
17029796 2006 C-phycocyanin transcriptionally regulates uPA mRNA through cAMP mediated PKA pathway in human fibroblast WI-38 cells.
17013094 2006 Autotaxin stimulates urokinase-type plasminogen activator expression through phosphoinositide 3-kinase-Akt-nuclear [corrected] factor kappa B signaling cascade in human melanoma cells.
16967469 2007 Association of tagSNPs in the urokinase-plasminogen activator (PLAU) gene with Alzheimer's disease and associated quantitative traits.
16949925 2006 Evaluation of urokinase plasminogen activator and its receptor in different grades of human prostate cancer.
16908524 2006 Pro-urokinase-type plasminogen activator is a substrate for hepsin.
16858643 2005 Circulating levels of urokinase-type plasminogen activator (uPA) and its soluble receptor (suPAR) in patients with atopic eczema/dermatitis syndrome.
16855359 2006 Expression of the fibrinolytic components in endometriosis.
16836076 2006 [Methylation status of uPA promoter in laryngeal squamous cell carcinoma].
16825821 2006 Association of Urokinase Gene 3'-UTR T/C polymorphism with bladder cancer.
16825285 2006 A functional polymorphism within plasminogen activator urokinase (PLAU) is associated with Alzheimer's disease.
16807059 2006 Human thyroid carcinoma cell invasion is controlled by the low density lipoprotein receptor-related protein-mediated clearance of urokinase plasminogen activator.
16806969 2006 Protein expression and preliminary crystallographic analysis of amino-terminal fragment of urokinase-type plasminogen activator.
16794252 2006 Initiation of plasminogen activation on the surface of monocytes expressing the type II transmembrane serine protease matriptase.
16761300 Recovery of urokinase from integrated mammalian cell culture cryogel bioreactor and purification of the enzyme using p-aminobenzamidine affinity chromatography.
16728704 2006 Urokinase-type plasminogen activator modulates airway eosinophil adhesion in asthma.
16685447 2006 Urokinase-type plasminogen activator induces proliferation in breast cancer cells.
16685436 2006 RNAi-mediated downregulation of urokinase plasminogen activator and its receptor in human meningioma cells inhibits tumor invasion and growth.
16632475 2006 Urokinase signaling through its receptor protects against anoikis by increasing BCL-xL expression levels.
16604464 2006 Urokinase-type plasminogen activator mRNA is expressed in normal developing teeth and leads to abnormal incisor enamel in alpha MUPA transgenic mice.
16601839 2006 High urokinase expression contributes to the angiogenic properties of endothelial cells derived from circulating progenitors.
16547007 2006 A region in urokinase plasminogen receptor domain III controlling a functional association with alpha5beta1 integrin and tumor growth.
16525631 2006 siRNA-mediated simultaneous downregulation of uPA and its receptor inhibits angiogenesis and invasiveness triggering apoptosis in breast cancer cells.
16509805 2006 Association of urokinase gene 3'-UTR polymorphism with calcium oxalate nephrolithiasis.
16504015 2006 Interleukin-1alpha enhances the aggressive behavior of pancreatic cancer cells by regulating the alpha6beta1-integrin and urokinase plasminogen activator receptor expression.
16461772 2006 Urokinase-type plasminogen activator receptor regulates a novel pathway of fibronectin matrix assembly requiring Src-dependent transactivation of epidermal growth factor receptor.
16459332 2006 The urokinase/PAI-2 complex: a new high affinity ligand for the endocytosis receptor low density lipoprotein receptor-related protein.
16456079 2006 Structure of human urokinase plasminogen activator in complex with its receptor.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16267271 2006 An uncleavable uPAR mutant allows dissection of signaling pathways in uPA-dependent cell migration.
16236890 2005 Sputum cathelicidin, urokinase plasminogen activation system components, and cytokines discriminate cystic fibrosis, COPD, and asthma inflammation.
16127174 2005 RNA interference-directed knockdown of urokinase plasminogen activator and urokinase plasminogen activator receptor inhibits prostate cancer cell invasion, survival, and tumorigenicity in vivo.
16113755 2005 [Tumor-associated prognostic factors of the plasminogen activator family: determination and clinical value of u-PA, t-PA, PAI-1, and PAI-2].
16102112 2005 A RUNX/AML-binding motif residing in a novel 13-bp DNA palindrome may determine the expression of the proximal promoter of the human uPA gene.
16077991 2005 Differential gene expression of urokinase-type plasminogen activator and its receptor in human renal cell carcinoma.
16008557 2005 Inhibition of urokinase receptor gene expression and cell invasion by anti-uPAR DNAzymes in osteosarcoma cells.
15996887 2005 The role of urokinase in innate immunity against Staphylococcus aureus.
15988036 2005 Platelet-derived growth factor D is activated by urokinase plasminogen activator in prostate carcinoma cells.
15944400 2005 Urokinase-induced activation of the gp130/Tyk2/Stat3 pathway mediates a pro-inflammatory effect in human mesangial cells via expression of the anaphylatoxin C5a receptor.
15937335 2005 Induction of p53 by urokinase in lung epithelial cells.
15927351 2005 Tumor necrosis factor alpha, CYP 17, urokinase, and interleukin 10 gene polymorphisms in postmenopausal women: correlation to bone mineral density and susceptibility to osteoporosis.
15886816 2005 Epidermal growth factor modulates prostate cancer cell invasiveness regulating urokinase-type plasminogen activator activity. EGF-receptor inhibition may prevent tumor cell dissemination.
15885322 2005 Evaluation of cerebrospinal fluid uPA, PAI-1, and soluble uPAR levels in HIV-infected patients.
15881651 2005 Protein synthesis and urokinase mRNA metabolism.
15880258 2005 Identification of a novel nucleus protein involved in the regulation of urokinase in 95D cells.
15868845 No association of urokinase gene 3'-UTR polymorphism with bronchopulmonary dysplasia for ventilated preterm infants.
15854129 2005 Involvement of urokinase-type plasminogen activator in sphingosylphosphorylcholine-induced angiogenesis.
15849510 2005 Insulinlike growth factor-I-mediated migration and invasion of human colon carcinoma cells requires activation of c-Met and urokinase plasminogen activator receptor.
15831288 2005 Basal release of urokinase plasminogen activator, plasminogen activator inhibitor-1, and soluble plasminogen activator receptor from separated and cultured endometriotic and endometrial stromal and epithelial cells.
15750768 2005 Distribution of C-->T and T-->C polymorphisms of the urokinase-type plasminogen activator gene in children with type 1 diabetes mellitus and insulin resistance.
15728176 2005 Dynamic assembly of the urokinase-type plasminogen activator signaling receptor complex determines the mitogenic activity of urokinase-type plasminogen activator.
15653692 2005 Signaling mechanisms responsible for lysophosphatidic acid-induced urokinase plasminogen activator expression in ovarian cancer cells.
15646834 The prognostic value of vascular endothelial growth factor, urokinase plasminogen activator and plasminogen activator inhibitor-1 in node-negative breast cancer.
15629242 2005 Sesamol regulates plasminogen activator gene expression in cultured endothelial cells: a potential effect on the fibrinolytic system.
15616835 2005 The urokinase-plasminogen activator (PLAU) gene is not associated with late onset Alzheimer's disease.
15615772 2005 Elevated amyloid beta protein (Abeta42) and late onset Alzheimer's disease are associated with single nucleotide polymorphisms in the urokinase-type plasminogen activator gene.
15558716 2005 No association of a non-synonymous PLAU polymorphism with Alzheimer's disease and disease-related traits.
15515049 2005 Expression of urokinase plasminogen activator, its receptor and type-1 inhibitor in malignant and benign prostate tissue.
15494526 2004 Urokinase induces basophil chemotaxis through a urokinase receptor epitope that is an endogenous ligand for formyl peptide receptor-like 1 and -like 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375521 2004 In situ gene expression of urokinase-type plasminogen activator and its receptor in transitional cell carcinoma of the human bladder.
15371454 2004 p38 Mitogen-activated protein kinase regulation of endothelial cell migration depends on urokinase plasminogen activator expression.
15356878 2004 Urokinase gene 3'-UTR T/C polymorphism is associated with oral cancer.
15326109 2004 Urokinase anchors uPAR to the actin cytoskeleton.
15262029 2004 Association between urokinase-plasminogen activator gene T4065C polymorphism and risk of mitral valve prolapse.
15243126 2004 Differential localization and expression of urokinase plasminogen activator (uPA), its receptor (uPAR), and its inhibitor (PAI-1) mRNA and protein in endometrial tissue during the menstrual cycle.
15231498 2004 Differential regulation of urokinase-type plasminogen activator expression by fluid shear stress in human coronary artery endothelial cells.
15217951 2004 Evaluation of nuclear factor-kappaB, urokinase-type plasminogen activator, and HBx and their clinicopathological significance in hepatocellular carcinoma.
15210852 2004 Small interfering RNA urokinase silencing inhibits invasion and migration of human hepatocellular carcinoma cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15149885 2004 Activation of PAF receptor by oxidised LDL in human monocytes stimulates chemokine releases but not urokinase-type plasminogen activator expression.
15083890 Association between urokinase gene 3'-UTR T/C polymorphism and Chinese patients with rheumatoid arthritis in Taiwan.
15067375 2004 Protein expression of MMP-13, uPA, and PAI-1 in pseudocapsular and interface tissue around implants of loose artificial hip joints and in osteoarthritis.
14983227 2004 The complex between urokinase-type plasminogen activator (uPA) and its type-1 inhibitor (PAI-I) independently predicts response to first-line endocrine therapy in advanced breast cancer.
14983219 2004 Urokinase-type plasminogen activator (uPA) and its inhibitor PAI-I: novel tumor-derived factors with a high prognostic and predictive impact in breast cancer.
14769799 2004 Integrin alphaMbeta2 orchestrates and accelerates plasminogen activation and fibrinolysis by neutrophils.
14747469 2004 Inhibition of tumor invasion by genomic down-regulation of matriptase through suppression of activation of receptor-bound pro-urokinase.
14744782 2004 Predictive impact of urokinase-type plasminogen activator: plasminogen activator inhibitor type-1 complex on the efficacy of adjuvant systemic therapy in primary breast cancer.
14704150 2004 Osteopontin induces AP-1-mediated secretion of urokinase-type plasminogen activator through c-Src-dependent epidermal growth factor receptor transactivation in breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14696115 2004 Regulation of carcinoma cell invasion by protein C inhibitor whose expression is decreased in renal cell carcinoma.
14681909 2004 Variation in the urokinase-plasminogen activator gene does not explain the chromosome 10 linkage signal for late onset AD.
14644829 2003 Urokinase-type plasminogen activator and insulin-like growth factor-binding protein 3 mRNA expression in endometriotic lesions and eutopic endometrium: implications for the pathophysiology of endometriosis.
14597629 2004 Genetic down-regulation of phosphoinositide 3-kinase by bikunin correlates with suppression of invasion and metastasis in human ovarian cancer HRA cells.
14534291 2003 Tyrosine kinase p56lck regulates cell motility and nuclear factor kappaB-mediated secretion of urokinase type plasminogen activator through tyrosine phosphorylation of IkappaBalpha following hypoxia/reoxygenation.
14531820 2003 Expression of urokinase plasminogen activator and its receptor during acute renal allograft rejection.
14517288 2003 Stabilization of urokinase and urokinase receptor mRNAs by HuR is linked to its cytoplasmic accumulation induced by activated mitogen-activated protein kinase-activated protein kinase 2.
14507113 2003 Pretreatment determination of the serum urokinase plasminogen activator and its soluble receptor in advanced small-cell lung cancer or non-small-cell lung cancer.
12960238 2003 The role of urokinase-type plasminogen activator (uPA)/uPA receptor in HIV-1 infection.
12941043 2003 Thrombus lysis by uPA, scuPA and tPA is regulated by plasma TAFI.
12930304 2003 Urokinase plasminogen activator mRNA is induced by IL-1alpha and TNF-alpha in in vitro acantholysis.
12926141 Clinical significance of expression of urokinase-type plasminogen activator in patients with prostate cancer.
12898287 2003 Association of late-onset Alzheimer disease with a genotype of PLAU, the gene encoding urokinase-type plasminogen activator on chromosome 10q22.2.
12883725 P38 MAPK pathway is involved in the urokinase plasminogen activator expression in human gastric SNU-638 cells.
12881310 2003 The kringle stabilizes urokinase binding to the urokinase receptor.
12832381 2003 Expression of several components of the plasminogen activator and matrix metalloproteinase systems in endometriosis.
12773490 2003 Methylation status of uPA promoter as a molecular mechanism regulating prostate cancer invasion and growth in vitro and in vivo.
12771144 2003 Osteopontin stimulates cell motility and nuclear factor kappaB-mediated secretion of urokinase type plasminogen activator through phosphatidylinositol 3-kinase/Akt signaling pathways in breast cancer cells.
12764090 2003 Exploitation of astrocytes by glioma cells to facilitate invasiveness: a mechanism involving matrix metalloproteinase-2 and the urokinase-type plasminogen activator-plasmin cascade.
12754271 2003 Amyloid beta-protein stimulates the expression of urokinase-type plasminogen activator (uPA) and its receptor (uPAR) in human cerebrovascular smooth muscle cells.
12743986 2003 A high cytosol value of urokinase-type plasminogen activator (uPA) may be predictive of early relapse in primary breast cancer.
12736046 2003 Association of plasma urokinase-type plasminogen activator and its receptor with clinical outcome in patients undergoing radical cystectomy for transitional cell carcinoma of the bladder.
12719789 2003 Urokinase-induced migration of human vascular smooth muscle cells requires coupling of the small GTPases RhoA and Rac1 to the Tyk2/PI3-K signalling pathway.
12719778 2003 Suppression of argatroban-induced endogenous thrombolysis by PKSI-527, and antibodies to TPA and UPA, evaluated in a rat arterial thrombolysis model.
12708473 2003 Urokinase-type plasminogen activator expression correlates with tumor angiogenesis and poor outcome in gastric cancer.
12704669 2003 Urokinase-mediated posttranscriptional regulation of urokinase-receptor expression in non small cell lung carcinoma.
12684636 Urokinase-type plasminogen activator and plasminogen activator inhibitor type 1 and type 2 in stage I malignant melanoma.
12642587 2003 Induction of plasminogen activator inhibitor-1 by urokinase in lung epithelial cells.
12576295 2003 Urokinase potentiates PDGF-induced chemotaxis of human airway smooth muscle cells.
12574820 2003 Human/chicken urokinase chimeras demonstrate sequences outside the serine protease domain that dictate autoactivation.
12556966 2003 Accumulation of uPA-PAI-1 complexes inside the tumour cells is associated with axillary nodal invasion in progesterone-receptor-positive early breast cancer.
12529357 2003 Anti-angiogenic activity of the recombinant kringle domain of urokinase and its specific entry into endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477728 2003 Syk, a protein-tyrosine kinase, suppresses the cell motility and nuclear factor kappa B-mediated secretion of urokinase type plasminogen activator by inhibiting the phosphatidylinositol 3'-kinase activity in breast cancer cells.
12430175 2002 Antigen levels of the urokinase-type plasminogen activator and its gene polymorphisms in colorectal cancer.
12393547 2003 Convergence of the adhesive and fibrinolytic systems: recognition of urokinase by integrin alpha Mbeta 2 as well as by the urokinase receptor regulates cell adhesion and migration.
12377770 2002 Rac1-MKK3-p38-MAPKAPK2 pathway promotes urokinase plasminogen activator mRNA stability in invasive breast cancer cells.
12353084 2002 Platelet associated u-PA up-regulates u-PA synthesis by endothelial cells.
12236587 2002 Cytoplasmic-nuclear shuttling of the urokinase mRNA binding protein regulates message stability.
12218297 Significance of urokinase-type plasminogen activator and plasminogen activator inhibitor-1 (PAI-1) expression in human colorectal carcinomas.
12183060 2002 Urokinase is required for the formation of mactinin, an alpha-actinin fragment that promotes monocyte/macrophage maturation.
12174885 The circulating urokinase plasminogen activator (uPA) and its soluble receptor (suPAR) are not up-regulated by the circulating P105 fraction of the HER-2/neu proto-oncogene: in vivo evidence from patients with advanced non-small cell lung cancer (NSCLC).
12167592 2002 Biphasic regulation of plasminogen activator/inhibitor by LDL in mesangial cells.
12161038 2002 Soluble urokinase receptor (uPAR, CD 87) is present in serum and cerebrospinal fluid in patients with neurologic diseases.
12152683 2002 Characterization of the binding of urokinase-type plasminogen activator to the asialoglycoprotein receptor.
12149463 2002 Increased expression of urokinase during atherosclerotic lesion development causes arterial constriction and lumen loss, and accelerates lesion growth.
12115506 2002 Expression of UPA and UPAR is associated with the clinical course of urinary bladder neoplasms.
12084931 2002 Urokinase-urokinase receptor interaction mediates an inhibitory signal for HIV-1 replication.
12041678 2002 Diagnostic significance of measurement of the receptor for urokinase-type plasminogen activator on granulocytes and in plasma from patients with paroxysmal nocturnal hemoglobinuria.
12023847 2002 Structural analysis of the interaction between urokinase-type plasminogen activator and its receptor: a potential target for anti-invasive cancer therapy.
12008951 2002 Differential effects of fibroblast growth factors on expression of genes of the plasminogen activator and insulin-like growth factor systems by human breast fibroblasts.
11956327 2002 The catalytic domain of endogenous urokinase-type plasminogen activator is required for the mitogenic activity of platelet-derived and basic fibroblast growth factors in human vascular smooth muscle cells.
11930938 2002 Activation of p38 MAP-kinase and caldesmon phosphorylation are essential for urokinase-induced human smooth muscle cell migration.
11928818 2002 Osteopontin modulates prostate carcinoma invasive capacity through RGD-dependent upregulation of plasminogen activators.
11928816 2002 Monocyte-expressed urokinase regulates human vascular smooth muscle cell migration in a coculture model.
11928812 2002 Induction of fibronectin mRNA by urokinase- and tissue-type plasminogen activator in human skin fibroblasts: differential role of u-PA and t-PA at the fibronectin protein level.
11928809 2002 Random peptide bacteriophage display as a probe for urokinase receptor ligands.
11928807 2002 Growth factor-dependent proliferation and invasion of muscle satellite cells require the cell-associated fibrinolytic system.
11928806 2002 Inhibition of receptor-dependent urokinase signaling by specific Ser to Glu substitutions.
11906036 2001 Urokinase plasminogen activator and TGF-beta production in immunosuppressed patients with and without Pneumocystis carinii.
11880102 2002 Urokinase gene 3'-UTR T/C polymorphism is associated with urolithiasis.
11876553 2001 A C/T polymorphism in the urokinase-type plasminogen activator gene in colorectal cancer.
11858184 2002 Enhanced PAI-1 levels from early second trimester and during labour and plasminogen activators in normal pregnancy.
11827968 2002 Exposure of cryptic domains in the alpha 1-chain of laminin-1 by elastase stimulates macrophages urokinase and matrix metalloproteinase-9 expression.
11805108 2002 Cooperativity between the Ras-ERK and Rho-Rho kinase pathways in urokinase-type plasminogen activator-stimulated cell migration.
11751384 2001 Pleiotrophic inhibition of pericellular urokinase-type plasminogen activator system by endogenous tumor suppressive maspin.
11501527 2001 Ligand binding regions in the receptor for urokinase-type plasminogen activator.
11394884 2001 Amino-terminal fragment of urokinase-type plasminogen activator inhibits HIV-1 replication.
11384978 2001 The putative tumor suppressor LRP1B, a novel member of the low density lipoprotein (LDL) receptor family, exhibits both overlapping and distinct properties with the LDL receptor-related protein.
11266465 2001 Plasminogen activator inhibitor 1 functions as a urokinase response modifier at the level of cell signaling and thereby promotes MCF-7 cell growth.
11023511 2000 Urokinase receptor expression on human microvascular endothelial cells is increased by hypoxia: implications for capillary-like tube formation in a fibrin matrix.
10996659 2000 The inactivation of single-chain urokinase-type plasminogen activator by thrombin on cultured human endothelial cells.
10962009 2000 Activation of hepatocyte growth factor and urokinase/plasminogen activator by matriptase, an epithelial membrane serine protease.
10805774 2000 (4-aminomethyl)phenylguanidine derivatives as nonpeptidic highly selective inhibitors of human urokinase.
10788498 2000 Post-transcriptional regulation of urokinase mRNA. Identification of a novel urokinase mRNA-binding protein in human lung epithelial cells in vitro.
10749881 2000 The chemotactic action of urokinase on smooth muscle cells is dependent on its kringle domain. Characterization of interactions and contribution to chemotaxis.
10636902 2000 A urokinase receptor-associated protein with specific collagen binding properties.
10505055 1999 Differential expression of proteases in human gestational tissues before, during and after spontaneous-onset labour at term.
10362070 1999 Co-localization of urokinase and its receptor on established human umbilical vein endothelial cell.
10361124 1999 Physical interaction between retinoic acid receptor and Sp1: mechanism for induction of urokinase by retinoic acid.
10340997 1999 Functionally inactive protein C inhibitor in seminal plasma may be associated with infertility.
10221568 1999 Elevation of serum levels of urokinase-type plasminogen activator and its receptor is associated with disease progression and prognosis in patients with prostate cancer.
9824347 1998 Urokinase and the intestinal mucosa: evidence for a role in epithelial cell turnover.
9766559 1998 Cancer cells overexpress mRNA of urokinase-type plasminogen activator, its receptor and inhibitors in human non-small-cell lung cancer tissue: analysis by Northern blotting and in situ hybridization.
9680361 1998 Effect of steroid hormones and retinoids on the formation of capillary-like tubular structures of human microvascular endothelial cells in fibrin matrices is related to urokinase expression.
9566979 1998 Mannose 6-phosphate/insulin-like growth factor-II receptor targets the urokinase receptor to lysosomes via a novel binding interaction.
9516128 1998 Vitronectin concentrates proteolytic activity on the cell surface and extracellular matrix by trapping soluble urokinase receptor-urokinase complexes.
9365930 1997 Assessment of the interaction between urokinase and reactive site mutants of protein C inhibitor.
9194591 1997 Mutational analysis of the genes encoding urokinase-type plasminogen activator (uPA) and its inhibitor PAI-1 in advanced ovarian cancer.
9151681 1997 Phosphorylation of human pro-urokinase on Ser138/303 impairs its receptor-dependent ability to promote myelomonocytic adherence and motility.
9143604 1997 Upregulation of urokinase-type plasminogen activator by endogenous and exogenous HIV-1 Tat protein in tumour cell lines derived from BK virus/tat-transgenic mice.
9065988 1997 Detection of polymorphisms in the human urokinase-type plasminogen activator gene.
8895530 1996 A pancreatic cancer-specific expression profile.
8837777 1996 The serpin PAI-1 inhibits cell migration by blocking integrin alpha V beta 3 binding to vitronectin.
8652631 1996 Characterization of single chain urokinase-type plasminogen activator with a novel amino-acid substitution in the kringle structure.
8591045 1995 The crystal structure of the catalytic domain of human urokinase-type plasminogen activator.
8428004 1993 The kinetics of plasminogen activation by thrombin-cleaved pro-urokinase and promotion of its activity by fibrin fragment E-2 and by tissue plasminogen activator.
8388810 1993 Processing of complex between urokinase and its type-2 inhibitor on the cell surface. A possible regulatory mechanism of urokinase activity.
8344937 1993 Epithelial glycoprotein-330 mediates endocytosis of plasminogen activator-plasminogen activator inhibitor type-1 complexes.
8270642 1993 Differential expression of plasminogen activators and their inhibitors in an organotypic skin coculture system.
8227186 1993 Expression and localization of elements of the plasminogen activation system in benign breast disease and breast cancers.
8107091 1994 Solution structure of the kringle domain from urokinase-type plasminogen activator.
8033079 1994 Expression and localization of urokinase-type plasminogen activator in human astrocytomas in vivo.
7904248 1993 A novel, specific pro-urokinase complex on monocyte-like cells, detected by transglutaminase-catalyzed cross-linking.
7867716 1995 Migrating vascular smooth muscle cells polarize cell surface urokinase receptors after injury in vitro.
7721771 1995 Tissue-type plasminogen activator (tPA) interacts with urokinase-type plasminogen activator (uPA) via tPA's lysine binding site. An explanation of the poor fibrin affinity of recombinant tPA/uPA chimeric molecules.
7592875 1995 The very low density lipoprotein receptor mediates the cellular catabolism of lipoprotein lipase and urokinase-plasminogen activator inhibitor type I complexes.
7559792 1995 Plasminogen activators augment endothelial cell organization in vitro by two distinct pathways.
7548163 1995 Production and characterization of recombinant human proteinase inhibitor 6 expressed in Pichia pastoris.
6754572 1982 The complete amino acid sequence of low molecular mass urokinase from human urine.
6754569 1982 The primary structure of high molecular mass urokinase from human urine. The complete amino acid sequence of the A chain.
6749491 1982 Human low-molecular-weight urinary urokinase. Partial characterization and preliminary sequence data of the two polypeptide chains.
6589620 1984 Identification and primary sequence of an unspliced human urokinase poly(A)+ RNA.
6364130 1984 Monoclonal antibodies to human urokinase identify the single-chain pro-urokinase precursor.
4226004 1967 The peptide chains of human plasmin. Mechanism of activation of human plasminogen to plasmin.
3933505 1985 Exon-intron boundary sliding in the generation of two mRNAs coding for porcine urokinase-like plasminogen activator.
3920216 1985 Binding and activation of plasminogen on the platelet surface.
3888571 1985 Molecular cloning, sequencing, and expression in Escherichia coli of human preprourokinase cDNA.
3840278 1985 Chromosomal locations of human tissue plasminogen activator and urokinase genes.
3501295 1987 Inhibition of urokinase by protein C-inhibitor (PCI). Evidence for identity of PCI and plasminogen activator inhibitor 3.
3090045 1986 Purification and characterization of a plasminogen activator inhibitor from the histiocytic lymphoma cell line U-937.
3031025 1987 The receptor-binding sequence of urokinase. A biological function for the growth-factor module of proteases.
3023326 1986 Binding of single-chain prourokinase to the urokinase receptor of human U937 cells.
2987867 1985 The human urokinase-plasminogen activator gene and its promoter.
2829380 1987 Receptor mediated binding of the fibrinolytic components, plasminogen and urokinase, to peripheral blood cells.
2752144 1989 Complex formation between urokinase and plasma protein C inhibitor in vitro and in vivo.
2544876 1989 Accessibility of receptor-bound urokinase to type-1 plasminogen activator inhibitor.
2536903 1989 Dynamics of the multidomain fibrinolytic protein urokinase from two-dimensional NMR.
2415429 1985 Molecular cloning of cDNA coding for human preprourokinase.
2166055 1990 The receptor for urokinase type plasminogen activator polarizes expression of the protease to the leading edge of migrating monocytes and promotes degradation of enzyme inhibitor complexes.
2161846 1990 Inhibition of receptor-bound urokinase by plasminogen-activator inhibitors.
2023947 1991 Characterization of a posttranslational fucosylation in the growth factor domain of urinary plasminogen activator.
1900515 1991 Cathepsin B efficiently activates the soluble and the tumor cell receptor-bound form of the proenzyme urokinase-type plasminogen activator (Pro-uPA).
1551416 1992 Effective activation of the proenzyme form of the urokinase-type plasminogen activator (pro-uPA) by the cysteine protease cathepsin L.
1499567 1992 Urokinase binding to laminin-nidogen. Structural requirements and interactions with heparin.
1334458 1992 Extracellular proteolytic cleavage by urokinase is required for activation of hepatocyte growth factor/scatter factor.
1327118 1992 Sequential 1H NMR assignments and secondary structure of the kringle domain from urokinase.
134998 1976 Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis.