Property Summary

Ligand Count 478
NCBI Gene PubMed Count 513
PubMed Score 1960.23
PubTator Score 2077.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Adenocarcinoma 122 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Angina Pectoris 32 0.0 0.0
Angina, Unstable 3 0.0 0.0
Anuria 9 0.0 0.0
Arterial Occlusive Diseases 3 0.0 0.0
Asthenozoospermia 3 0.0 0.0
Asthma 385 0.0 0.0
Bone neoplasms 8 0.0 0.0
Brain Edema 50 0.0 0.0
Brain Ischemia 110 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Carotid Artery Diseases 11 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Cerebral Infarction 10 0.0 0.0
Cerebrovascular Disorders 2 0.0 0.0
Coronary Disease 25 0.0 0.0
Embolism, Cholesterol 2 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Graft Occlusion, Vascular 1 0.0 0.0
Heart Rupture, Post-Infarction 1 0.0 0.0
Hematuria 36 0.0 0.0
Hemorrhage 19 0.0 0.0
Hypotension 82 0.0 0.0
Idiopathic pulmonary fibrosis 23 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Intracranial Embolism and Thrombosis 2 0.0 0.0
Intracranial Hemorrhages 16 0.0 0.0
Ischemia 28 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Nephritis 51 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary embolism 55 0.0 0.0
Purpura, Schoenlein-Henoch 2 0.0 0.0
Quebec platelet disorder 2 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Sagittal Sinus Thrombosis 3 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Thromboembolism 15 0.0 0.0
Thrombosis 46 0.0 0.0
Venous Thrombosis 47 0.0 0.0
Ventricular Fibrillation 17 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
substance-related disorder 162 0.0 0.7

Expression

  Differential Expression (28)

Disease log2 FC p
active ulcerative colitis 1.015 4.6e-02
adult high grade glioma 2.000 4.1e-03
Astrocytoma, Pilocytic 2.800 2.2e-08
Atopic dermatitis 1.300 2.3e-04
atypical teratoid / rhabdoid tumor 2.700 2.3e-04
Breast cancer 2.600 2.5e-02
colon cancer 1.700 8.0e-03
cystic fibrosis 2.596 4.6e-06
ependymoma 1.300 2.7e-03
gastric carcinoma 2.000 2.7e-02
glioblastoma 1.500 9.8e-04
interstitial cystitis 1.800 2.2e-04
interstitial lung disease 1.100 4.3e-02
intraductal papillary-mucinous adenoma (... -1.600 7.3e-03
invasive ductal carcinoma 1.332 4.7e-02
lung adenocarcinoma 1.300 2.3e-06
medulloblastoma, large-cell 1.400 6.4e-05
Multiple Sclerosis -1.100 6.5e-04
nasopharyngeal carcinoma 1.500 1.6e-05
non diabetic and post-ischemic heart fai... -1.200 2.6e-03
non-small cell lung cancer 1.871 8.5e-13
osteosarcoma 2.359 2.5e-03
ovarian cancer 3.900 3.5e-05
pancreatic cancer 2.000 3.6e-05
pancreatic ductal adenocarcinoma liver m... 1.327 2.8e-02
primitive neuroectodermal tumor 1.300 1.9e-02
psoriasis 1.700 1.5e-04
tuberculosis -1.800 1.4e-05

Protein-protein Interaction (2)

PDB (121)

Gene RIF (451)

AA Sequence

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC      1 - 70
YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK     71 - 140
PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG    141 - 210
GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK    211 - 280
IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY    281 - 350
YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR    351 - 420
SHTKEENGLAL                                                               421 - 431
//

Text Mined References (516)

PMID Year Title