Property Summary

NCBI Gene PubMed Count 22
PubMed Score 48.31
PubTator Score 17.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma 1.200 4.3e-06
malignant mesothelioma 2.000 1.3e-07
osteosarcoma -1.825 3.1e-05
atypical teratoid / rhabdoid tumor 1.500 1.5e-07
glioblastoma 1.300 1.5e-05
medulloblastoma, large-cell 1.500 1.2e-04
primitive neuroectodermal tumor 1.100 8.2e-05
intraductal papillary-mucinous neoplasm ... 1.100 5.0e-03
colon cancer 1.200 6.9e-03
pediatric high grade glioma 1.100 2.1e-06
spina bifida -1.237 3.2e-02
Bipolar Disorder 1.088 2.3e-02
acute myeloid leukemia 1.200 1.3e-02
ovarian cancer 1.300 6.9e-10

Gene RIF (14)

PMID Text
25031728 Our findings indicate that PALGL2 serves as a tumor oncoprotein in the development and progression of colorectal cancer
24675530 PLAGL2 expression induces lamellipodia formation and disruption of stress fiber formation.
22076304 PLAGL2 regulate cell cycle and apoptosis via activation of the p53 family member, p73, in human promonocytic U937 cells.
20478531 Transcriptome analysis revealed that these differentiation-suppressive activities are attributable in part to PLAGL2 modulation of Wnt/beta-catenin signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20025940 The data identify PC2 as a novel PLAGL2-binding protein and important mediator of PLAGL2 transactivation.
19574421 Increased cell injury and/or death could be caused directly by the upregulation of bNip3, a preapoptotic molecule that dimerizes with Bcl-2, or indirectly by the aberrant expression of SP-C-induced endoplasmic reticulum stress in epithelial cells.
18655774 These data suggests that Ubc9 can function as a co-factor of PLAGL2, uncoupling from its enzymatic activity, to mediate PLAGL2 interactive SP-C promoter activity.
17950244 This study thus uncovers a novel function of PLAGL2 as an oncoprotein through regulating the stability of Pirh2.
17618602 Nuclear PLAGL2 occupied and transactivated the endogenous SP-C promoter in hypoxic lung cells.These results further suggest that PLAGL2 is an oxidative stress responding regulator in lung cells.
17551969 Coexpression of Tip60 and PLAGL2 completely abolishes the sumoylation of PLAGL2.
17462995 These data clearly identify PLAGL2 as a novel regulator of NCF2/p67phox gene expression as well as NADPH oxidase activity and contribute to a greater understanding of the transcriptional regulation of NCF2.
15585652 Plag1 and Plagl2 are novel leukemia oncogenes that act by expanding hematopoietic progenitors expressing CbF beta-SMMHC.
15361364 PLAGL2 may modulate SP-C expression during lung development.

AA Sequence

MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSC      1 - 70
PQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKL     71 - 140
GYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHL    141 - 210
VVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMAS    211 - 280
RDVMGTKAFPGMLPMGMYGAHIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYL    281 - 350
PDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF    351 - 420
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFTSGLSSTTLPR    421 - 490
FHQAFQ                                                                    491 - 496
//

Text Mined References (23)

PMID Year Title
25031728 2014 The role of pleomorphic adenoma gene-like 2 in gastrointestinal cancer development, progression, and prognosis.
24675530 2014 PLAGL2 regulates actin cytoskeletal architecture and cell migration.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22076304 2012 Pleomorphic adenoma gene-like 2 regulates expression of the p53 family member, p73, and induces cell cycle block and apoptosis in human promonocytic U937 cells.
20478531 2010 PLAGL2 regulates Wnt signaling to impede differentiation in neural stem cells and gliomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20025940 2010 Modulation of PLAGL2 transactivation by positive cofactor 2 (PC2), a component of the ARC/Mediator complex.
19574421 2009 PLAGL2 expression-induced lung epithelium damages at bronchiolar alveolar duct junction in emphysema: bNip3- and SP-C-associated cell death/injury activity.
18655774 2008 Modulation of PLAGL2 transactivation activity by Ubc9 co-activation not SUMOylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17950244 2007 PLAGL2 controls the stability of Pirh2, an E3 ubiquitin ligase for p53.
17618602 2007 PLAGL2 translocation and SP-C promoter activity--a cellular response of lung cells to hypoxia.
17551969 2008 Tip60 modulates PLAGL2-mediated transactivation by acetylation.
17462995 2007 Binding of pleomorphic adenoma gene-like 2 to the tumor necrosis factor (TNF)-alpha-responsive region of the NCF2 promoter regulates p67(phox) expression and NADPH oxidase activity.
15585652 2005 Plag1 and Plagl2 are oncogenes that induce acute myeloid leukemia in cooperation with Cbfb-MYH11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361364 2005 Pleiomorphic adenoma gene-like-2, a zinc finger protein, transactivates the surfactant protein-C promoter.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11498794 2001 Involvement of PLAGL2 in activation of iron deficient- and hypoxia-induced gene expression in mouse cell lines.
9722527 1998 Transcriptional activation capacity of the novel PLAG family of zinc finger proteins.
8724849 1996 Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1.