Tbio | Zinc finger protein PLAGL1 |
Shows weak transcriptional activatory activity. Transcriptional regulator of the type 1 receptor for pituitary adenylate cyclase-activating polypeptide.
This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causal factor for transient neonatal diabetes mellitus (TNDM). Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding two different protein isoforms. The P1 downstream promoter of this gene is imprinted, with preferential expression from the paternal allele in many tissues. [provided by RefSeq, Nov 2015]
This gene encodes a C2H2 zinc finger protein that functions as a suppressor of cell growth. This gene is often deleted or methylated and silenced in cancer cells. In addition, overexpression of this gene during fetal development is thought to be the causal factor for transient neonatal diabetes mellitus (TNDM). Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding two different protein isoforms. The P1 downstream promoter of this gene is imprinted, with preferential expression from the paternal allele in many tissues. [provided by RefSeq, Nov 2015]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Diabetes Mellitus, Transient Neonatal, 1 | 4 | 0.0 | 0.0 |
Stomach Neoplasms | 300 | 0.0 | 0.0 |
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2843 | 4.5e-40 |
Breast cancer | 3578 | 7.1e-12 |
non-small cell lung cancer | 2890 | 9.2e-12 |
pituitary cancer | 1972 | 6.2e-11 |
juvenile dermatomyositis | 1187 | 1.7e-10 |
malignant mesothelioma | 3232 | 3.5e-08 |
Duchenne muscular dystrophy | 601 | 6.1e-06 |
breast carcinoma | 1638 | 3.2e-05 |
invasive ductal carcinoma | 2951 | 4.1e-05 |
ovarian cancer | 8520 | 5.1e-05 |
Pick disease | 1894 | 7.1e-04 |
ductal carcinoma in situ | 1745 | 1.1e-03 |
lung cancer | 4740 | 2.8e-03 |
dermatomyositis | 966 | 3.7e-03 |
atypical teratoid / rhabdoid tumor | 5112 | 4.7e-03 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 6.2e-03 |
Polycystic ovary syndrome | 360 | 1.3e-02 |
spina bifida | 1074 | 1.6e-02 |
aldosterone-producing adenoma | 665 | 1.8e-02 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 1.9e-02 |
glioblastoma | 5792 | 2.2e-02 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 2.8e-02 |
colon cancer | 1478 | 3.2e-02 |
active ulcerative colitis | 764 | 3.6e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Beckwith-Wiedemann syndrome | 44 | 3.984 | 2.0 |
Pleomorphic adenoma | 18 | 3.843 | 1.9 |
Hereditary spastic paraplegia 17 | 16 | 3.695 | 1.8 |
Silver-Russell syndrome | 39 | 3.512 | 1.8 |
diabetes mellitus | 1728 | 3.405 | 1.7 |
Disease | Target Count |
---|---|
Transient neonatal diabetes mellitus | 14 |
Transient neonatal diabetes mellitus 1 | 2 |
Disease | log2 FC | p |
---|---|---|
active ulcerative colitis | -1.253 | 3.6e-02 |
aldosterone-producing adenoma | -1.402 | 1.8e-02 |
atypical teratoid / rhabdoid tumor | 2.000 | 4.7e-03 |
autosomal dominant Emery-Dreifuss muscul... | 1.412 | 6.2e-03 |
Breast cancer | -2.900 | 7.1e-12 |
breast carcinoma | -1.500 | 3.2e-05 |
colon cancer | -1.900 | 3.2e-02 |
dermatomyositis | 1.200 | 3.7e-03 |
Duchenne muscular dystrophy | 1.501 | 6.1e-06 |
ductal carcinoma in situ | -1.600 | 1.1e-03 |
glioblastoma | -1.200 | 2.2e-02 |
intraductal papillary-mucinous adenoma (... | -1.400 | 1.9e-02 |
intraductal papillary-mucinous neoplasm ... | -2.100 | 2.8e-02 |
invasive ductal carcinoma | -1.753 | 4.1e-05 |
juvenile dermatomyositis | 1.670 | 1.7e-10 |
lung cancer | -1.500 | 2.8e-03 |
lung carcinoma | -2.400 | 4.5e-40 |
malignant mesothelioma | -4.500 | 3.5e-08 |
non-small cell lung cancer | -1.251 | 9.2e-12 |
ovarian cancer | -3.100 | 5.1e-05 |
Pick disease | 1.100 | 7.1e-04 |
pituitary cancer | -5.000 | 6.2e-11 |
Polycystic ovary syndrome | 1.050 | 1.3e-02 |
spina bifida | -1.569 | 1.6e-02 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
OMA EggNOG |
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQKSHQCAHCEKT 1 - 70 FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLK 71 - 140 AHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQE 141 - 210 LMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPE 211 - 280 SLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFD 281 - 350 LAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ 351 - 420 QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR 421 - 463 //