Property Summary

NCBI Gene PubMed Count 61
PubMed Score 100.04
PubTator Score 90.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.000 2.4e-07
psoriasis -1.400 8.8e-04
posterior fossa group B ependymoma 2.000 1.6e-06
medulloblastoma, large-cell -1.200 2.8e-04
lung cancer 2.800 3.1e-05
interstitial cystitis -1.400 2.3e-04
lung carcinoma 1.300 3.0e-11
Breast cancer -1.100 1.4e-04
ovarian cancer 1.700 3.0e-03

Gene RIF (44)

PMID Text
26492619 The Thr34 of PLAG1 is critical for LpMab-10 recognition.
25786906 Data indicate that SLIT2, miR-218-1, RET/PLAG1 and SLIT2/ROBO1 pathway involved in Hirschsprung's disease.
25439740 Fluorescence in situ hybridization for PLAG1 or HMGA2 can be used to distinguish between pleomorphic adenoma and carcinoma ex-pleomorphic adenoma and their morphologic mimics.
25060425 The nuclear import of PLAG1 by KPNA2 is essential for the role of KPNA2 in HCC cells.
24700772 lipoblastoma is a group of lipomatous tumors with PLAG1 rearrangement and overexpression.
24516594 Altogether, these data suggest that HMGA2 is an upstream activator of PLAG1.
24468654 Lacrimal and salivary gland PAs and Ca-ex-PAs have similar genomic profiles and frequently overexpress the PLAG1 oncoprotein. Copy number gains involving 9p23-p22.3 (NFIB) and 22q12-qter (PDGFB) may be of importance for disease progression.
24433523 Report illustrates two different tumorigenic pathways implicating PLAG1 in lipoblastoma: amplification through multiple copies of a small marker chromosome derived from chromosome 8, and a paracentric inversion of the long arm of chromosome 8. Review.
24185117 Extraskeletal myxoid chondrosarcoma of the vulva with PLAG1 gene activation: molecular genetic characterization of 2 cases
23958548 a marker with good specificity for salivary gland pleomorphic adenomas
23738717 Ten cases of salivary duct carcinoma had PLAG1 rearrangement/amplification (22.7%) and eight had HMGA2 (18.2%) rearrangement/amplification.
23690029 PLAG1 not only activates genes that promote cell proliferation and tumor formation but also genes that inhibit these cellular processes.
23630011 A subset of cutaneous and soft tissue ME tumors appears genetically linked to their salivary gland counterparts, displaying frequent PLAG1 gene rearrangements and occasionally LIFR-PLAG1 fusion.
23554918 miR-141 contributes to fetal growth restriction by regulating PLAG1 expression.
23404581 These results suggest that PLAG1 and CYLD do not play a role in ACC tumorigenesis.
23023303 PLAG1 binding to the IGF2 P3 promoter and IGF2 expression is cell type-specific, and that the PLAG1 transcription factor acts as a transcriptional facilitator that partially overrides the insulation by the H19 ICR.
22593475 PLAG1 is evidently not involved in the development of myoepithelial tumours. The proportion of 8q12-alterations in myoepithelial tumours was very low.
22485045 We conclude that most Carcinoma ex pleomorphic adenoma, regardless of morphologic subtype,carry altered PLAG1 genes
22192798 PLAG1 immunohistochemistry is useful for distinguishing lipoblastoma from other lipomatous tumors including liposarcoma.
22038920 myoepithelial tumors with PLAG1 alteration share a common morphologic phenotype with salivary gland-like morphology and are genetically related to their salivary gland counterpart
21927843 close relationship between cutaneous mixed tumors and pleomorphic adenomas of the salivary gland. However, the mechanism of PLAG1 expression in cutaneous mixed tumors appears to be possibly different from that of pleomorphic adenomas.
21394649 present results also suggest that overexpression of PLAG1 is essential for the tumorigenesis of pleomorphic adenomas, although the mechanisms mediating PLAG1 overexpression seem to be variable.
20687796 Overexpression of the oncogene PLAG1 is associated with the pathogenesis of chronic lymphocytic leukemia.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20522588 Overexpression in transgenic mice causes hypereinsulinemic normoglycemia and insulin resistance.
20189936 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19692702 a significant regulation of PLAG1 by miR-181a, miR-181b, miR-107, and miR-424.
19347935 overexpression of PLAG1 is associated with pleomorphic adenomas of the salivary gland.
19266077 Observational study of gene-disease association. (HuGE Navigator)
18269579 Fluorescence in situ hybridization (FISH) demonstrated rearrangements of the PLAG1 region in lipoblastoma in adolescencts and young adults.
18059337 Molecular analyses in salivary gland tumors revealed that ring formation consistently generated novel FGFR1-PLAG1 gene fusions in which the 5'-part of FGFR1 is linked to the coding sequence of PLAG1
17693184 PLAG1 gene rearrangements is associated with pleomorphic adenoma
17332914 The importance and versatility of the PLAG1 oncogene in tumourigenesis is discussed.
16736500 PLAG1 protein is overexpressed in epithelial, myoepithelial, and mesenchymal-like tumor cells in tumors with fusions to CHCHD7 and TCEA1.
16108035 Overexpression of PLAG1 is associated with pleomorphic adenomas in transgenic mice
15930271 Results establish the in vivo tumorigenic capacity of PLAG1 and indicate that the transgenic mice constitute a valuable model for pleomorphic salivary gland tumorigenesis and potentially for other glands as well.
15920557 Finding reinforces the role of PLAG1 on the tumorigenesis of benign and malignant pleomorphic adenoma.
15642402 fusion with HAS2 in lipoblastoma
15585652 Plag1 and Plagl2 are novel leukemia oncogenes that act by expanding hematopoietic progenitors expressing CbF beta-SMMHC.
15262430 PLAG1 amplification is associated with malignant mixed tumor of salivary gland
15208321 a direct repression of the transactivating capacity of the oncoprotein PLAG1 by SUMOylation
14695992 PLAG1 regulates promoter P3-dependent transcription of IGF2 in hepatoblastomas.
11894114 overexpression of PLAG1 does not depend on chromosomal rearrangements in radiation associated pleomorphic adenomas
11882654 Identification of a karyopherin alpha 2 recognition site in PLAG1, which functions as a nuclear localization signal

AA Sequence

MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCT      1 - 70
KAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHL     71 - 140
ALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDRRFYTRKDVRRHMVVHTGR    141 - 210
KDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSK    211 - 280
PFTNTLQLNLYNTPFQSMQSSGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQ    281 - 350
PLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ    351 - 420
LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTST    421 - 490
TLPRFHQAFQ                                                                491 - 500
//

Text Mined References (66)

PMID Year Title
26492619 2015 Development of Monoclonal Antibody LpMab-10 Recognizing Non-glycosylated PLAG1/2 Domain Including Thr34 of Human Podoplanin.
25786906 2015 SLIT2/ROBO1-miR-218-1-RET/PLAG1: a new disease pathway involved in Hirschsprung's disease.
25439740 2015 Consistent PLAG1 and HMGA2 abnormalities distinguish carcinoma ex-pleomorphic adenoma from its de novo counterparts.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25060425 2014 Pleomorphic adenoma gene 1 mediates the role of karyopherin alpha 2 and has prognostic significance in hepatocellular carcinoma.
24700772 2014 Identification of COL3A1 and RAB2A as novel translocation partner genes of PLAG1 in lipoblastoma.
24516594 2014 Correlated expression of HMGA2 and PLAG1 in thyroid tumors, uterine leiomyomas and experimental models.
24468654 2014 Lacrimal gland pleomorphic adenoma and carcinoma ex pleomorphic adenoma: genomic profiles, gene fusions, and clinical characteristics.
24433523 2014 Diagnostic utility of molecular and cytogenetic analysis in lipoblastoma: a study of two cases and review of the literature.
24185117 2014 Extraskeletal myxoid chondrosarcoma of the vulva with PLAG1 gene activation: molecular genetic characterization of 2 cases.
23958548 Diagnostic utility of PLAG1 immunohistochemical determination in salivary gland tumors.
23738717 2013 An analysis of PLAG1 and HMGA2 rearrangements in salivary duct carcinoma and examination of the role of precursor lesions.
23690029 2013 Opposing functions of PLAG1 in pleomorphic adenoma: a microarray analysis of PLAG1 transgenic mice.
23630011 2013 Frequent PLAG1 gene rearrangements in skin and soft tissue myoepithelioma with ductal differentiation.
23554918 2013 miR-141 contributes to fetal growth restriction by regulating PLAG1 expression.
23404581 2013 PLAG1 and CYLD do not play a role in the tumorigenesis of adenoid cystic carcinoma.
23023303 2012 Cell type and context-specific function of PLAG1 for IGF2 P3 promoter activity.
22593475 2012 Chromosomal rearrangements in PLAG1 of myoepithelial salivary gland tumours.
22485045 2012 PLAG1 alteration in carcinoma ex pleomorphic adenoma: immunohistochemical and fluorescence in situ hybridization studies of 22 cases.
22192798 2012 PLAG1 expression in mesenchymal tumors: an immunohistochemical study with special emphasis on the pathogenetical distinction between soft tissue myoepithelioma and pleomorphic adenoma of the salivary gland.
22038920 2012 A subset of cutaneous and soft tissue mixed tumors are genetically linked to their salivary gland counterpart.
21927843 2011 PLAG1 expression in cutaneous mixed tumors: an immunohistochemical and molecular genetic study.
21394649 2011 Aberrant PLAG1 expression in pleomorphic adenomas of the salivary gland: a molecular genetic and immunohistochemical study.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20687796 2010 Critical role of microRNAs in chronic lymphocytic leukemia: overexpression of the oncogene PLAG1 by deregulated miRNAs.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20522588 2010 Increased beta-cell mass by islet transplantation and PLAG1 overexpression causes hyperinsulinemic normoglycemia and hepatic insulin resistance in mice.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19692702 2009 miRNA deregulation by epigenetic silencing disrupts suppression of the oncogene PLAG1 in chronic lymphocytic leukemia.
19396169 2009 A large-scale genome-wide association study of Asian populations uncovers genetic factors influencing eight quantitative traits.
19347935 2009 Alterations in miRNA processing and expression in pleomorphic adenomas of the salivary gland.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18269579 2008 Lipoblastoma in adolescents and young adults: report of six cases with FISH analysis.
18059337 2008 High-resolution array CGH analysis of salivary gland tumors reveals fusion and amplification of the FGFR1 and PLAG1 genes in ring chromosomes.
17693184 2007 Heterogeneity of PLAG1 gene rearrangements in pleomorphic adenoma.
17332914 2007 PLAG1, the prototype of the PLAG gene family: versatility in tumour development (review).
16736500 2006 CHCHD7-PLAG1 and TCEA1-PLAG1 gene fusions resulting from cryptic, intrachromosomal 8q rearrangements in pleomorphic salivary gland adenomas.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16207715 2005 Sumoylation and acetylation play opposite roles in the transactivation of PLAG1 and PLAGL2.
16108035 2006 Wnt pathway is involved in pleomorphic adenomas induced by overexpression of PLAG1 in transgenic mice.
15930271 2005 Salivary gland tumors in transgenic mice with targeted PLAG1 proto-oncogene overexpression.
15920557 2005 PLAG1 gene alterations in salivary gland pleomorphic adenoma and carcinoma ex-pleomorphic adenoma: a combined study using chromosome banding, in situ hybridization and immunocytochemistry.
15642402 2005 PLAG1-HAS2 fusion in lipoblastoma with masked 8q intrachromosomal rearrangement.
15585652 2005 Plag1 and Plagl2 are oncogenes that induce acute myeloid leukemia in cooperation with Cbfb-MYH11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262430 2004 Amplification of MGC2177, PLAG1, PSMC6P, and LYN in a malignant mixed tumor of salivary gland detected by cDNA microarray with tyramide signal amplification.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15208321 2004 Repression of the Transactivating Capacity of the Oncoprotein PLAG1 by SUMOylation.
14712223 2004 Microarray screening for target genes of the proto-oncogene PLAG1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695992 2004 Amplification and overexpression of the IGF2 regulator PLAG1 in hepatoblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11894114 2002 Expression of PLAG1 and HMGIC proteins and fusion transcripts in radiation-associated pleomorphic adenomas.
11888928 2002 The tumorigenic diversity of the three PLAG family members is associated with different DNA binding capacities.
11882654 2002 Identification of a karyopherin alpha 2 recognition site in PLAG1, which functions as a nuclear localization signal.
10987300 2000 PLAG1 fusion oncogenes in lipoblastoma.
10646861 2000 PLAG1, the main translocation target in pleomorphic adenoma of the salivary glands, is a positive regulator of IGF-II.
10029085 1999 Conserved mechanism of PLAG1 activation in salivary gland tumors with and without chromosome 8q12 abnormalities: identification of SII as a new fusion partner gene.
9722527 1998 Transcriptional activation capacity of the novel PLAG family of zinc finger proteins.
9525740 1998 The recurrent translocation t(5;8)(p13;q12) in pleomorphic adenomas results in upregulation of PLAG1 gene expression under control of the LIFR promoter.
9268638 1997 A 2-Mb YAC contig and physical map covering the chromosome 8q12 breakpoint cluster region in pleomorphic adenomas of the salivary glands.
9020842 1997 Promoter swapping between the genes for a novel zinc finger protein and beta-catenin in pleiomorphic adenomas with t(3;8)(p21;q12) translocations.