Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.82
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.048 6.6e-04
Atopic dermatitis -1.500 8.6e-04
breast carcinoma -1.900 2.1e-04
cystic fibrosis -2.794 5.1e-07
ductal carcinoma in situ -2.500 1.4e-03
fibroadenoma -2.800 1.3e-03
intraductal papillary-mucinous adenoma (... -1.200 3.4e-04
intraductal papillary-mucinous carcinoma... -1.200 4.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.5e-03
invasive ductal carcinoma -1.161 8.0e-03
lung adenocarcinoma -1.600 4.7e-15
non-small cell lung cancer -3.157 2.7e-32
ovarian cancer -1.100 1.6e-06
posterior fossa group A ependymoma 1.300 3.8e-06
psoriasis -1.300 9.4e-34

AA Sequence

MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGL      1 - 70
LGLLEELAWNLPPGPFSPAPDLLGDGF                                                71 - 97
//

Text Mined References (6)

PMID Year Title