Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.73
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
cystic fibrosis -2.794 5.1e-07
Atopic dermatitis -1.500 8.6e-04
adrenocortical carcinoma -1.048 6.6e-04
non-small cell lung cancer -3.157 2.7e-32
intraductal papillary-mucinous adenoma (... -1.200 3.4e-04
intraductal papillary-mucinous carcinoma... -1.200 4.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.5e-03
breast carcinoma -1.900 2.1e-04
fibroadenoma -2.800 1.3e-03
posterior fossa group B ependymoma 1.800 5.4e-06
lung adenocarcinoma -1.600 4.7e-15
invasive ductal carcinoma -3.700 3.2e-04
ductal carcinoma in situ -2.500 1.4e-03
ovarian cancer -1.100 1.6e-06
psoriasis -1.300 9.4e-34

AA Sequence

MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGL      1 - 70
LGLLEELAWNLPPGPFSPAPDLLGDGF                                                71 - 97
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12758124 2003 Plac8 and Plac9, novel placental-enriched genes identified through microarray analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.