Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.0e-08
diabetes mellitus 1728 1.5e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.5e-03
osteosarcoma -1.438 4.0e-08

 Compartment GO Term (2)

AA Sequence

MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGG      1 - 70
GWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLA     71 - 140
VHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV                                     141 - 177
//

Text Mined References (5)

PMID Year Title