Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.0e-08
diabetes mellitus 1663 1.5e-03


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.438 4.0e-08
diabetes mellitus 1.100 1.5e-03

AA Sequence

VHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV                                     141 - 177

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.