Property Summary

NCBI Gene PubMed Count 14
PubMed Score 62.46
PubTator Score 376.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.700 3.1e-04
Astrocytoma, Pilocytic 2.400 3.6e-05
colon cancer -1.700 1.2e-02
cutaneous lupus erythematosus 5.100 2.7e-06
ependymoma 1.100 1.8e-03
glioblastoma 1.500 2.6e-04
interstitial cystitis 2.700 5.9e-03
intraductal papillary-mucinous adenoma (... 4.900 3.4e-05
intraductal papillary-mucinous carcinoma... 4.700 1.9e-04
intraductal papillary-mucinous neoplasm ... 6.000 5.0e-04
lung adenocarcinoma -1.500 1.1e-04
lung cancer -3.200 6.1e-04
lung carcinoma -2.300 5.7e-18
malignant mesothelioma 6.000 2.5e-09
nasopharyngeal carcinoma -2.000 5.2e-03
nephrosclerosis 1.028 2.7e-02
non-small cell lung cancer -1.766 3.9e-08
osteosarcoma -5.323 2.7e-07
pancreatic cancer 2.800 7.4e-06
periodontitis 1.200 1.7e-15
primary pancreatic ductal adenocarcinoma 2.522 3.7e-02
primary Sjogren syndrome 2.300 2.0e-04
psoriasis 1.500 1.2e-21
tuberculosis 1.300 1.0e-04
Waldenstrons macroglobulinemia 2.009 7.2e-03

 GO Function (1)

Gene RIF (9)

AA Sequence

MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAM      1 - 70
RTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF                              71 - 115
//

Text Mined References (14)

PMID Year Title