Property Summary

NCBI Gene PubMed Count 28
PubMed Score 50.40
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.1e-15
medulloblastoma, large-cell 6234 4.6e-04
osteosarcoma 7933 2.4e-02
Disease Target Count Z-score Confidence
pre-eclampsia 67 3.552 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.202 2.4e-02
medulloblastoma, large-cell 1.200 4.6e-04
psoriasis -1.600 1.1e-15

Synonym

Accession Q9HBJ0
Symbols CT92
OOSP2L

Gene

  Ortholog (2)

Gene RIF (23)

PMID Text
26157147 PLAC1/CP1 provides a marker for identifying gastric cancers with poor prognosis, and suggest that PLAC1/CP1 may provide a useful target for immunotherapy.
25138310 circulating mRNA improved detection rate of pre-eclampsia
24989904 Data suggests that PLAC1 plays an important role in human placental trophoblast invasion and migration.
24912876 This data suggests that the Epstein-Barr virus-induced PLAC1 is a member of the cancer/testis group of tumor antigens.
24304549 NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1.
23604623 PLAC1/CP1 antigen is a possible prognostic marker of colorectal carcinoma, and PLAC1/CP1 p41-50 and PLAC1/CP1 p69-77 are novel HLA-A*0201-restricted CD8+ T cell epitopes
23434395 we identified a novel specific antitrophoblast antibody, anti-PLAC1, in infertile women with repeated unexplained implantation failure. PLAC1 shows placenta-specific expression and is localized primarily in the syncytiotrophoblast.
21937108 RXRalpha and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer.
21215095 The expression of PLAC1/CP1 genes correlates with various clinical and pathologic parameters in primary colorectal carcinoma.
20509147 A potential role for PLAC1 as a biomarker predictive of specific pregnancy complications, such as preeclampsia.
19705800 In normal tissues, PLAC1 expression was restricted to the placenta while developmental pluripotency associated-2 expression was restricted to the placenta and testis.
19652226 analysis of activation of trophoblast-specific PLAC1 in breast cancer by CCAAT/enhancer-binding protein beta (C/EBPbeta) isoform 2
18183594 3.8% (4/101) of HCC patients had anti-PLAC1 antibody response, suggesting the immunogenicity of PLAC1 in HCC patients. PLAC1 represents a new class of tumor associated antigen with restricted expression in placenta and cancer tissues.
17983203 study demonstrated that PLAC1 is a novel tumor antigen with very restricted normal tissue expression; also evidence provided that PLAC1 is expressed in the tumor cells in a subset of lung cancer patients
17909063 RNAi-mediated silencing of PLAC1 in MCF-7 and BT-549 breast cancer cells profoundly impairs motility, migration, and invasion and induces a G1-S cell cycle block with nearly complete abrogation of proliferation.
17554801 CRH, PLAC1, and selectin-P are distributed differently in preeclampsia cases compared to controls and correlate with signs of preeclampsia.
17186554 Data show that PLAC1 is restricted primarily to the differentiated trophoblast, localizing to intracellular membranous compartment(s) in the apical region of the syncytiotrophoblast and associated with its apical, microvillous membrane surface.
16860456 In induced term pregnancies, PLAC1 mRNA in maternal blood at the beginning of the treatment correlates with time elapsed before delivery; this demonstrates that fetomaternal trafficking of nucleic acids is more consistent when labor is about to begin.
16594548 Plasma PLAC1 and glial cells-missing 1 mRNAs appear promising as noninvasively measurable molecular markers for pre-eclampsia
15803460 PLAC1 expression is upregulated during trophoblast differentiation, localizing primarily to the differentiated syncytiotrophoblast.
15608456 mRNA transcripts from placenta-expressed specific gene are detectable in maternal blood and rapidly disappear after delivery
12412044 PLAC1, a trophoblast-specific gene, is Trophoblast-specific expression throughout gestation and responsiveness to KGF are consistent with a fundamental role for PLAC1 at the maternal-fetal interface.

AA Sequence

MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA      1 - 70
YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA     71 - 140
QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG    141 - 210
SM                                                                        211 - 212
//

Text Mined References (28)

PMID Year Title
26157147 2015 New tumour antigen PLAC1/CP1, a potentially useful prognostic marker and immunotherapy target for gastric adenocarcinoma.
25138310 2014 Circulating mRNA for the PLAC1 gene as a second trimester marker (14-18 weeks' gestation) in the screening for late preeclampsia.
24989904 2014 Role of placenta-specific protein 1 in trophoblast invasion and migration.
24912876 2014 The placental specific gene, PLAC1, is induced by the Epstein-Barr virus and is expressed in human tumor cells.
24304549 2013 NCOA3 is a selective co-activator of estrogen receptor ?-mediated transactivation of PLAC1 in MCF-7 breast cancer cells.
23604623 2014 Identification of two new HLA-A*0201-restricted cytotoxic T lymphocyte epitopes from colorectal carcinoma-associated antigen PLAC1/CP1.
23434395 2013 Preliminary evidence for high anti-PLAC1 antibody levels in infertile patients with repeated unexplained implantation failure.
21937108 2011 RXR? and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 2012 Identification of a novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 in breast cancer.
21215095 2010 [Expression of PLAC1/CP1 genes in primary colorectal carcinoma and its clinical significance].
20509147 2010 PLAC1 (Placenta-specific 1): a novel, X-linked gene with roles in reproductive and cancer biology.
19705800 2009 Expression and serum immunoreactivity of developmentally restricted differentiation antigens in epithelial ovarian cancer.
19652226 2009 Selective activation of trophoblast-specific PLAC1 in breast cancer by CCAAT/enhancer-binding protein beta (C/EBPbeta) isoform 2.
18183594 2008 Plac1 is a tumor-specific antigen capable of eliciting spontaneous antibody responses in human cancer patients.
17983203 2007 PLAC1, a trophoblast-specific cell surface protein, is expressed in a range of human tumors and elicits spontaneous antibody responses.
17909063 2007 A placenta-specific gene ectopically activated in many human cancers is essentially involved in malignant cell processes.
17554801 2007 Cell-free mRNA concentrations of CRH, PLAC1, and selectin-P are increased in the plasma of pregnant women with preeclampsia.
17186554 2007 The PLAC1 protein localizes to membranous compartments in the apical region of the syncytiotrophoblast.
16860456 2007 PLAC1 mRNA levels in maternal blood at induction of labor correlate negatively with induction-delivery interval.
16594548 2006 Increased plasma mRNAs of placenta-specific 1 (PLAC1) and glial cells-missing 1 (GCM1) in mothers with pre-eclampsia.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15803460 2005 PLAC1 expression increases during trophoblast differentiation: evidence for regulatory interactions with the fibroblast growth factor-7 (FGF-7) axis.
15608456 Rapid clearance of mRNA for PLAC1 gene in maternal blood after delivery.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12412044 2002 PLAC1, a trophoblast-specific gene, is expressed throughout pregnancy in the human placenta and modulated by keratinocyte growth factor.
10995572 2000 PLAC1, an Xq26 gene with placenta-specific expression.