Property Summary

NCBI Gene PubMed Count 240
PubMed Score 325.75
PubTator Score 783.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Obesity 655
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Atherosclerosis 276 5.175 2.6
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.4e-03
Atopic dermatitis -1.300 2.1e-02
COPD 2.300 3.6e-02
cutaneous lupus erythematosus 2.700 4.9e-04
ductal carcinoma in situ 2.100 6.4e-03
head and neck cancer and chronic obstruc... 1.800 7.2e-03
interstitial cystitis 3.200 7.3e-04
invasive ductal carcinoma 2.300 2.2e-03
lung adenocarcinoma 1.300 3.1e-04
lung carcinoma -2.300 4.1e-09
nasopharyngeal carcinoma 1.600 1.2e-04
non-small cell lung carcinoma 1.800 2.1e-16
primary Sjogren syndrome 1.500 5.7e-05
psoriasis -1.200 8.9e-03
sarcoidosis 2.900 4.5e-02
tuberculosis -2.000 3.6e-05
ulcerative colitis 2.400 4.6e-08

Protein-protein Interaction (1)

Gene RIF (235)

AA Sequence

MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDL      1 - 70
MFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRP     71 - 140
GEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLK    141 - 210
QEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVI    211 - 280
QTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSV    281 - 350
HQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT    351 - 420
NINTTNQHIMLQNSSGIEKYN                                                     421 - 441
//

Text Mined References (242)

PMID Year Title