Property Summary

NCBI Gene PubMed Count 116
PubMed Score 337.28
PubTator Score 228.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.321 2.8e-05

 IMPC Phenotype (1)

Gene RIF (97)

PMID Text
27196560 PLA2G6 mutations in Indian patients with infantile neuroaxonal dystrophy and atypical late-onset neuroaxonal dystrophy
27030050 This study demonstrated that elevated expression of alphaSyn/PalphaSyn in mitochondria appears to be the early response to PLA2G6-deficiency in neurons.
26755131 Analysis of the cells from idiopathic Parkinson's disease patients reveals a significant deficiency in store-operated PLA2g6-dependent Ca(2+) signalling
26668131 Mutations in PLA2G6 altered Golgi morphology, O-linked glycosylation and sialylation of protein in patients with neurodegeneration
26525102 genetic association study in Quebec City population: Data suggest total plasma n-6 fatty acid phospholipid levels and C-reactive protein are modulated by SNPs in PLA2G4A and PLA2G6 alone or in combination with fish oil dietary supplementation.
26446356 Three catalytically active cPLA2, iPLA2, and sPLA2 are expressed in different areas within the human spermatozoon cell body. Spermatozoa with a significant low motility showed strong differences both in terms of total specific activity and of different intracellular distribution, compared with normal spermatozoa. Phospholipases could be potential biomarkers of asthenozoospermia.
26160611 Results demonstrated no significant impact of PLA2G6 and PLA2G4C gene polymorphisms on attenuated niacin skin flushing in schizophrenia patients.
26001724 our findings demonstrate that loss of normal PLA2G6 gene activity leads to lipid peroxidation, mitochondrial dysfunction and subsequent mitochondrial membrane abnormalities.
25668476 Mutations in PANK2 and CoASY lead, respectively, to PKAN and CoPAN forms of Neurodegeneration with brain iron accumulation . Mutations in PLA2G6 lead to PLAN. Mutations in C19orf12 lead to MPAN
25482049 Stimulation of adrenoreceptors causes increased iPLA2 expression via MAP kinase/ERK 1/2.
25207958 genetic association studies in a population of Han Chinese: Data suggest that SNPs in PLA2G6 (rs132984; rs2284060) are associated with type 2 diabetes and hypertriglyceridemia in the population studied. [Meta-Analysis included]
25004092 IL-1beta and IFNgamma induces mSREBP-1 and iPLA2beta expression and induce beta-cell apoptosis.
24858037 The loss of PS2 could have a critical role in lung tumor development through the upregulation of iPLA2 activity by reducing gamma-secretase.
24791136 The significance of calcium-independent phospholipase A, group VIA (iPLA2-VIA), in retinal pigment epithelial cell survival, was investigated.
24745848 Novel PLA2G6 mutations were identified in all patients with Phospholipase A2 associated neurodegeneration.
24522175 clinical findings may be helpful in distinguishing PLA2G6-related neurodegeneration from the other major cause of NBIA, recessive PANK2 mutations.
24512906 our findings indicate that PRDX6 promotes lung tumor growth via increased glutathione peroxidase and iPLA2 activities
24130795 the phenotype of neurodegeneration associated with PLA2G6 mutations
23587695 This study demonistrated that PLA2g8 expression was significantly decreased in patients treated with antipsychotic drug.
23277130 The association with bipolar disorder of the iPLA2beta (PLA2G6) its genetic interaction with type 2 transient receptor potential channel gene TRPM2, was examined.
23196729 Mutations in PLA2G6 is often associated with rapidly progressive parkinsonism and with additional features including pyramidal signs, cognitive decline and loss of sustained Levodopa responsiveness.
23182313 identified four rare PLA2G6 mutations in 250 PD patients in Chinese population with Parkinson's disease
23074238 Findings reveal for the first time expression of iPLA(2)beta protein in human islet beta-cells and that induction of iPLA(2)beta during endoplasmic reticulum stress contributes to human islet beta-cell apoptosis.
23043102 Orai1 and PLA2g6 are involved in adhesion formation, whereas STIM1 participates in both adhesion formation and disassembly.
23007400 membrane composition and the presence of nucleotides play key roles in recruiting and modulating GVIA-iPLA(2) activity in cells
22903185 Neuronal phospholipid deacylation is essential for axonal and synaptic integrity through the action of iPLA2 and NTE. (Review)
22680611 The present study confirms the involvement of iPLA(2)-VIA in efficient retinal pigment epithelium phagocytosis of photoreceptor outer segments.
22549787 These data confirm the role of iPLA(2)beta as an essential mediator of endogenous store operated calcium entry.
22459563 The results of this study suggested that PLA2G6 is not a susceptibility gene for parkinson disease in our population.
22406380 Our result indicated that PLA2G6 mutations might not be a main cause of Chinese sporadic early-onset parkinsonism.
22218592 acts as an inhibitory modulator of NKCC2 activity in thick ascending limb
22213678 PLA2G6 mutations are associated with PARK14-linked young-onset parkinsonism and sporadic Parkinson's disease
21812034 A possible involvement of calcium-independent group VI phospholipase A2 (iPLA2-VI) in the pathogenesis of Parkinson's disease has been proposed.
21700586 tHIS STUDY DEMONISTRATED THAT the PLA2G6 gene allocated PARK14 locus and is associated with autosomal recessive early-onset parkinsonism.
21482170 data indicate that PLA2G6 mutation may not play a major role in general frontotemporal type of dementia
21368765 PLA2G6 mutations are unlikely to be the major causes or risk factors of Parkinson's disease at least in Asian populations
21191104 These results indicate that cardiac endothelial cell PAF production is dependent on iPLA(2)beta activation and that both iPLA(2)beta and iPLA(2)gamma may be involved in PGI(2) release.
20938027 The results of this study suggested that PLA2G6 mutations should be considered in patients with early-onset l-dopa-responsive parkinsonism and dementia with frontotemporal lobar atrophy.
20938027 Observational study of gene-disease association. (HuGE Navigator)
20886109 Catalytic function of PLA2G6 impaired by mutations is associated with infantile neuroaxonal dystrophy.
20881058 The A isoform of PLA2G6 was shown to play a role in controlling the architecture of the endoplasmic reticulum-golgi intermediate compartment proteins in a way that impacts transport.
20813170 This study demonistrated that pLA2G6 has a dynamic expression pattern both in terms of the location of expression and the differentiation state of expressing cells.
20669327 We identified genetic deficits in PLA2G6 that were associated with Levodopa responsive parkinsonism with pyramidal signs.
20647408 Observational study of gene-disease association. (HuGE Navigator)
20629144 Genetically determined NBIA cases from the Indian subcontinent suggest presence of unusual phenotypes of PANK2 and novel mutations
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619503 This report further defines the clinical features and neuropathology of PLA2G6 related childhood and adult onset dystonia-parkinsonism .
20584031 Compound heterozygosity for a large intragenic deletion and a nonsense mutation was found in one patient with infantile neuroaxonal dystrophy while the other is carrying two novel splice-site mutations
20464283 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219570 Results characterize a pathway leading to NOX2 activation in which iPLA(2)-regulated p38 MAPK activity is a key regulator of S100A8/A9 translocation via S100A9 phosphorylation.
20186954 Our data suggest that PLA2G6 mutations are unlikely to be an important cause of the common garden variety of Parkinson's disease patients with dystonia or a positive family history
20186954 Observational study of gene-disease association. (HuGE Navigator)
20171194 These data demonstrate the novel findings that iPLA2 inhibition activates p38 by inducing reactive species, and further suggest that this signaling kinase is involved in p53 activation, cell cycle arrest and cytostasis.
20053941 iPLA2 expression is increased in neutrophils from people with diabetes and mediates superoxide generation, presenting an alternate pathway independent of protein kinase C and phosphatidic acid phosphohydrolase-1 hydrolase signaling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578365 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19556238 The region with the greatest change upon lipid binding in phospholipase A2 group VI was region 708-730.
19225567 Chromofungin or Catestatin , penetrate into PMNs, inducing extracellular calcium entry by a CaM-regulated iPLA2 pathway.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19138334 The nine novel mutations identified in this study suggest the uniqueness of the PLA2G6 mutation spectrum in Chinese patients
19087156 Different and even identical PLA2G6 mutations may cause neurodegenerative diseases with heterogeneous clinical manifestations, including dystonia-parkinsonism.
19059366 iPLA2 activity is responsible for membrane phospholipid hydrolysis in response to tryptase or thrombin stimulation in pulmonary vascular endothelial cells
18826942 H2O2-mediated hyperoxidation of Prdx6 induces cell cycle arrest at the G2/M transition through up-regulation of iPLA2 activity.
18799783 PLA2G6 mutations are associated with nearly all cases of classic infantile neuroaxonal dystrophy.
18799783 Observational study of gene-disease association. (HuGE Navigator)
18790994 Tryptase stimulation of human small airway epithelial cells increased membrane-associated, calcium-independent phospholipase A(2)gamma (iPLA(2)gamma) activity, resulting in increased arachidonic acid and PGE(2) release.
18775417 This review discusses the role of iPLA2 in cell growth with special emphasis placed on its role in cell signaling; the putative lipid signals involved are also discussed.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18570303 PLA2G6 mutations are associated with infantile neuroaxonal dystrophy and have been reported previously to cause early cerebellar signs, and the syndrome was classified as neurodegeneration with brain iron accumulation (type 2).
18562188 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18208975 iPLA(2)beta and cPLA(2)alpha regulate monocyte migration from different intracellular locations, with iPLA(2)beta acting as a critical regulator of the cellular compass.
17459165 oxytocin stimulation of uterine PGF2alpha production is mediated, at least in part, by up-regulation of PLA2G6 expression and activity
17275398 Secretion and activity of sPLA(2) were found to be similar in granulocyte-like PLB cells expressing or lacking cPLA(2)alpha, indicating that they are not under cPLA(2)alpha regulation.
17254819 Cerebellar atrophy without cerebellar cortex hyperintensity in infantile neuroaxonal dystrophy (INAD) due to PLA2G6 mutation.
17188740 human coronary artery endothelial cells exposed to thrombin or tryptase stimulation demonstrated an increase in iPLA2 activity and arachidonic acid release
17082190 Transient receptor potential subfamily M member 8 (TRPM8) channel is stimulated by the Ca2+-independent phospholipase A2 (iPLA2) signaling pathway with its end products, lysophospholipids, acting as its endogenous ligands.
17033970 The disease gene was mapped to a 1.17-Mb locus on chromosome 22q13.1.
17003039 The role of calcium influx factor and PLA2G6 in the activation of CRAC channels and calcium entry in rat tumor cell lines is reported.
16966332 iPLA2-VIA is a novel regulator of endothelial cell S phase progression, cell cycle residence, and angiogenesis
16943248 Increase in iPLA(2) and accumulation of membrane phospholipid-derived metabolites in HCAEC exposed to hypoxia or thrombin have important implications in inflammation and arrhythmogenesis in atherosclerosis/thrombosis and myocardial ischemia.
16783378 mapped a locus for infantile neuroaxonal dystrophy (INAD) and neurodegeneration with brain iron accumulation (NBIA) to chromosome 22q12-q13 and identified mutations in PLA2G6, encoding a group VI phospholipase A2, in NBIA, INAD and Karak syndrome
16585943 This study reviews the evidence and discusses the potential roles of phospholipase A2 Group 6A for schizophrenia with particular emphasis on published association studies.
15573142 Detailed characterization of group VIA phospholipase A2 beta suggests that the pancreatic islet beta-cells express multiple isoforms of iPLA2beta; the hypothesis in this review is that these isozymes participate in different cellular functions.
15385540 truncated iPLA(2) proteins associate with active iPLA(2) and down-regulate its activity during G(1)
15364929 iPLA2epsilon (adiponutrin), iPLA2zeta (TTS-2.2), and iPLA2eta (GS2) are three novel TAG lipases/acylglycerol transacylases that likely participate in TAG hydrolysis and the acyl-CoA independent transacylation of acylglycerols
15318030 Observational study of gene-disease association. (HuGE Navigator)
15252038 iPLA2 may be dispensable for the apoptotic process to occur
15249229 Here we show that the C-terminal region of human iPLA(2)gamma is responsible for the enzymatic activity.
15052324 The GVIB iPLA2 is widely expressed in human tissues but is enriched in heart, placenta, and skeletal muscle.
14749286 Arachidonic acid produced by iPLA(2)beta-catalyzed hydrolysis of their substrates induces release of Ca(2+) from ER stores, an event thought to participate in glucose-stimulated insulin secretion.
12423354 stimulation of three isoforms of PLA2 by thapsigargin liberates free AA that, in turn, induces capacitative calcium influx in human T-cells
12208880 activation during apoptosis promotes the exposure of membrane lysophosphatidylcholine leading to binding by natural immunoglobulin M antibodies and complement activation
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR      1 - 70
LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI     71 - 140
ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV    141 - 210
AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH    211 - 280
SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG    281 - 350
NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG    351 - 420
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKG    421 - 490
LIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL    491 - 560
EEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLV    561 - 630
WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQ    631 - 700
VPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIML    701 - 770
DEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP                                      771 - 806
//

Text Mined References (115)

PMID Year Title
27196560 2016 Genetic Analysis of PLA2G6 in 22 Indian Families with Infantile Neuroaxonal Dystrophy, Atypical Late-Onset Neuroaxonal Dystrophy and Dystonia Parkinsonism Complex.
27030050 2016 High expression of ?-synuclein in damaged mitochondria with PLA2G6 dysfunction.
26755131 2016 Impairment of PARK14-dependent Ca(2+) signalling is a novel determinant of Parkinson's disease.
26668131 2016 Disruption of Golgi morphology and altered protein glycosylation in PLA2G6-associated neurodegeneration.
26525102 2015 Modulation of C-reactive protein and plasma omega-6 fatty acid levels by phospholipase A2 gene polymorphisms following a 6-week supplementation with fish oil.
26446356 2015 Asthenozoospermia and membrane remodeling enzymes: a new role for phospholipase A2.
26160611 2015 Polymorphisms in PLA2G6 and PLA2G4C genes for calcium-independent phospholipase A2 do not contribute to attenuated niacin skin flush response in schizophrenia patients.
26001724 2015 Loss of PLA2G6 leads to elevated mitochondrial lipid peroxidation and mitochondrial dysfunction.
25668476 2015 Mitochondria: A crossroads for lipid metabolism defect in neurodegeneration with brain iron accumulation diseases.
25482049 2016 Regulation of Calcium-Independent Phospholipase A2 Expression by Adrenoceptors and Sterol Regulatory Element Binding Protein-Potential Crosstalk Between Sterol and Glycerophospholipid Mediators.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25207958 2015 Genetic variants of PLA2G6 are associated with Type 2 diabetes mellitus and triglyceride levels in a Chinese population.
25004092 2014 Evidence of contribution of iPLA2?-mediated events during islet ?-cell apoptosis due to proinflammatory cytokines suggests a role for iPLA2? in T1D development.
24858037 2014 Loss of presenilin 2 is associated with increased iPLA2 activity and lung tumor development.
24791136 2014 Calcium-independent phospholipase A?, group VIA, is critical for RPE cell survival.
24745848 2014 PLA2G6-associated neurodegeneration (PLAN): further expansion of the clinical, radiological and mutation spectrum associated with infantile and atypical childhood-onset disease.
24522175 2014 Ophthalmic features of PLA2G6-related paediatric neurodegeneration with brain iron accumulation.
24512906 2014 PRDX6 promotes lung tumor progression via its GPx and iPLA2 activities.
24130795 2013 New findings in a global approach to dissect the whole phenotype of PLA2G6 gene mutations.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23749988 2013 Recessive truncating NALCN mutation in infantile neuroaxonal dystrophy with facial dysmorphism.
23587695 2013 Antipsychotic drugs decrease iPLA2 gene expression in schizophrenia.
23277130 2013 Association of the iPLA2? gene with bipolar disorder and assessment of its interaction with TRPM2 gene polymorphisms.
23196729 2012 Early-onset autosomal-recessive parkinsonian-pyramidal syndrome.
23182313 2013 Four novel rare mutations of PLA2G6 in Chinese population with Parkinson's disease.
23074238 2012 Role of calcium-independent phospholipase A(2)? in human pancreatic islet ?-cell apoptosis.
23043102 2012 Role of molecular determinants of store-operated Ca(2+) entry (Orai1, phospholipase A2 group 6, and STIM1) in focal adhesion formation and cell migration.
23007400 2012 Roles of acidic phospholipids and nucleotides in regulating membrane binding and activity of a calcium-independent phospholipase A2 isoform.
22903185 2013 Neuronal phospholipid deacylation is essential for axonal and synaptic integrity.
22680611 2012 Diverse regulation of retinal pigment epithelium phagocytosis of photoreceptor outer segments by calcium-independent phospholipase A?, group VIA and secretory phospholipase A?, group IB.
22549787 2012 Overexpression of Orai1 and STIM1 proteins alters regulation of store-operated Ca2+ entry by endogenous mediators.
22459563 2012 Association between PLA2G6 gene polymorphisms and Parkinson's disease in the Chinese Han population.
22406380 2012 Analysis of PLA2G6 gene mutation in sporadic early-onset parkinsonism patients from Chinese population.
22218592 2012 Group VIA phospholipase A2 is a target for vasopressin signaling in the thick ascending limb.
22213678 2012 PLA2G6 mutations in PARK14-linked young-onset parkinsonism and sporadic Parkinson's disease.
21983787 2011 Genome-wide association study identifies three new melanoma susceptibility loci.
21812034 2011 The PLA2G6 gene in early-onset Parkinson's disease.
21700586 2011 PLA2G6 gene mutation in autosomal recessive early-onset parkinsonism in a Chinese cohort.
21482170 2011 Analysis of PLA2G6 in patients with frontotemporal type of dementia.
21478494 2011 Genome-wide association study identifies nidogen 1 (NID1) as a susceptibility locus to cutaneous nevi and melanoma risk.
21368765 2011 PLA2G6 variant in Parkinson's disease.
21191104 2011 Activation of group VI phospholipase A2 isoforms in cardiac endothelial cells.
20938027 2010 Phenotypic spectrum of patients with PLA2G6 mutation and PARK14-linked parkinsonism.
20886109 2010 Catalytic function of PLA2G6 is impaired by mutations associated with infantile neuroaxonal dystrophy but not dystonia-parkinsonism.
20881058 2010 ADP ribosylation factors 1 and 4 and group VIA phospholipase A? regulate morphology and intraorganellar traffic in the endoplasmic reticulum-Golgi intermediate compartment.
20813170 2010 Expression of PLA2G6 in human fetal development: Implications for infantile neuroaxonal dystrophy.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20669327 2010 Early-onset L-dopa-responsive parkinsonism with pyramidal signs due to ATP13A2, PLA2G6, FBXO7 and spatacsin mutations.
20647408 2010 Melanocytic nevi, nevus genes, and melanoma risk in a large case-control study in the United Kingdom.
20629144 2010 Indian-subcontinent NBIA: unusual phenotypes, novel PANK2 mutations, and undetermined genetic forms.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619503 2012 Widespread Lewy body and tau accumulation in childhood and adult onset dystonia-parkinsonism cases with PLA2G6 mutations.
20584031 2010 Novel splice-site mutations and a large intragenic deletion in PLA2G6 associated with a severe and rapidly progressive form of infantile neuroaxonal dystrophy.
20464283 2010 Study of association between genetic polymorphisms of phospholipase A2 enzymes and Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20219570 2010 iPLA2, a novel determinant in Ca2+- and phosphorylation-dependent S100A8/A9 regulated NOX2 activity.
20186954 2010 PLA2G6 mutations and Parkinson's disease.
20171194 2010 Inhibition of calcium-independent phospholipase A2 activates p38 MAPK signaling pathways during cytostasis in prostate cancer cells.
20053941 2010 Diabetes-induced oxidative stress is mediated by Ca2+-independent phospholipase A2 in neutrophils.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19578365 2009 Genome-wide association study identifies variants at 9p21 and 22q13 associated with development of cutaneous nevi.
19578364 2009 Genome-wide association study identifies three loci associated with melanoma risk.
19556238 2009 Localizing the membrane binding region of Group VIA Ca2+-independent phospholipase A2 using peptide amide hydrogen/deuterium exchange mass spectrometry.
19225567 2009 Two chromogranin a-derived peptides induce calcium entry in human neutrophils by calmodulin-regulated calcium independent phospholipase A2.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19164547 2009 Role of calcium-independent phospholipase A2 in the pathogenesis of Barth syndrome.
19138334 2009 Clinical study and PLA2G6 mutation screening analysis in Chinese patients with infantile neuroaxonal dystrophy.
19087156 2009 R632W mutation in PLA2G6 segregates with dystonia-parkinsonism in a consanguineous Iranian family.
19059366 2009 Inhibition of calcium-independent phospholipase A2 prevents inflammatory mediator production in pulmonary microvascular endothelium.
19029121 2009 Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions.
18826942 2008 H2O2-dependent hyperoxidation of peroxiredoxin 6 (Prdx6) plays a role in cellular toxicity via up-regulation of iPLA2 activity.
18799783 2008 Neurodegeneration associated with genetic defects in phospholipase A(2).
18790994 2008 Tryptase activates calcium-independent phospholipase A2 and releases PGE2 in airway epithelial cells.
18775417 2008 Role of Ca2+-independent phospholipase A2 in cell growth and signaling.
18714013 2008 The major bactericidal activity of human seminal plasma is zinc-dependent and derived from fragmentation of the semenogelins.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18570303 2009 Characterization of PLA2G6 as a locus for dystonia-parkinsonism.
18562188 2008 BanI polymorphism of cytosolic phospholipase A2 gene is associated with age at onset in male patients with schizophrenia and schizoaffective disorder.
18208975 2008 iPLA2beta: front and center in human monocyte chemotaxis to MCP-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17459165 2007 Distinct phospholipase A2 enzymes regulate prostaglandin E2 and F2alpha production by bovine endometrial epithelial cells.
17275398 2007 Differential behavior of sPLA2-V and sPLA2-X in human neutrophils.
17254819 2007 Cerebellar atrophy without cerebellar cortex hyperintensity in infantile neuroaxonal dystrophy (INAD) due to PLA2G6 mutation.
17188740 2007 Protease activation of calcium-independent phospholipase A2 leads to neutrophil recruitment to coronary artery endothelial cells.
17082190 2006 Ca2+-independent phospholipase A2-dependent gating of TRPM8 by lysophospholipids.
17033970 2006 PLA2G6 mutation underlies infantile neuroaxonal dystrophy.
17003039 2006 Activation mechanism for CRAC current and store-operated Ca2+ entry: calcium influx factor and Ca2+-independent phospholipase A2beta-mediated pathway.
16966332 2006 Group VIA calcium-independent phospholipase A2 mediates endothelial cell S phase progression.
16943248 2007 Calcium-independent phospholipase A2-catalyzed plasmalogen hydrolysis in hypoxic human coronary artery endothelial cells.
16799181 2006 Characterization of the human patatin-like phospholipase family.
16783378 2006 PLA2G6, encoding a phospholipase A2, is mutated in neurodegenerative disorders with high brain iron.
16585943 2006 The role of phospholipases A2 in schizophrenia.
15573142 2004 The expression and function of a group VIA calcium-independent phospholipase A2 (iPLA2beta) in beta-cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15385540 2004 Cell cycle dependence of group VIA calcium-independent phospholipase A2 activity.
15364929 2004 Identification, cloning, expression, and purification of three novel human calcium-independent phospholipase A2 family members possessing triacylglycerol lipase and acylglycerol transacylase activities.
15318030 2004 Allelic association analysis of phospholipase A2 genes with schizophrenia.
15252038 2004 Role of group VIA calcium-independent phospholipase A2 in arachidonic acid release, phospholipid fatty acid incorporation, and apoptosis in U937 cells responding to hydrogen peroxide.
15249229 2004 Catalytic residues of group VIB calcium-independent phospholipase A2 (iPLA2gamma).
15052324 2004 Regulation of arachidonic acid availability for eicosanoid production.
14749286 2004 Beta-cell calcium-independent group VIA phospholipase A(2) (iPLA(2)beta): tracking iPLA(2)beta movements in response to stimulation with insulin secretagogues in INS-1 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634037 2004 Role of an endoplasmic reticulum Ca2+-independent phospholipase A2 in cisplatin-induced renal cell apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12423354 2002 Role of three isoforms of phospholipase A2 in capacitative calcium influx in human T-cells.
12208880 2002 I-PLA(2) activation during apoptosis promotes the exposure of membrane lysophosphatidylcholine leading to binding by natural immunoglobulin M antibodies and complement activation.
10591208 1999 The DNA sequence of human chromosome 22.
10336645 1999 The human calcium-independent phospholipase A2 gene multiple enzymes with distinct properties from a single gene.
10092647 1999 Human pancreatic islets express mRNA species encoding two distinct catalytically active isoforms of group VI phospholipase A2 (iPLA2) that arise from an exon-skipping mechanism of alternative splicing of the transcript from the iPLA2 gene on chromosome 22q13.1.
9417066 1998 Multiple splice variants of the human calcium-independent phospholipase A2 and their effect on enzyme activity.
9079687 1997 A novel cytosolic calcium-independent phospholipase A2 contains eight ankyrin motifs.