Property Summary

Ligand Count 17
NCBI Gene PubMed Count 47
PubMed Score 26.19
PubTator Score 44.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.900 1.8e-02
atypical teratoid / rhabdoid tumor -2.000 7.3e-04
ependymoma -1.900 4.0e-02
glioblastoma multiforme 1.300 1.3e-06
group 3 medulloblastoma -2.100 3.4e-04
invasive ductal carcinoma -1.200 1.1e-02
lung adenocarcinoma -1.100 3.6e-13
lung cancer -1.200 1.2e-03
medulloblastoma, large-cell -3.000 9.6e-05
oligodendroglioma -1.700 4.4e-02
osteosarcoma -1.671 2.5e-02
primitive neuroectodermal tumor -1.200 6.1e-03

Gene RIF (31)

AA Sequence

MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHC      1 - 70
YGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS       71 - 138
//

Text Mined References (47)

PMID Year Title