Property Summary

NCBI Gene PubMed Count 45
PubMed Score 26.72
PubTator Score 44.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.900 1.8e-02
ependymoma -1.900 4.0e-02
oligodendroglioma -1.700 4.4e-02
glioblastoma multiforme 1.300 1.3e-06
osteosarcoma -1.671 2.5e-02
sonic hedgehog group medulloblastoma -3.200 2.5e-08
atypical teratoid / rhabdoid tumor -2.000 7.3e-04
medulloblastoma, large-cell -3.000 9.6e-05
primitive neuroectodermal tumor -2.700 2.0e-03
lung cancer -1.200 1.2e-03
lung adenocarcinoma -1.100 3.6e-13
invasive ductal carcinoma -1.200 1.1e-02

Protein-protein Interaction (4)

Gene RIF (29)

PMID Text
25549071 The clinical findings in this family suggest a diagnosis of benign familial fleck retina with excellent prognosis, in which the PLA2G5 gene may play a role.
25247183 Summarizing, Der p1 and Fel d1 involve phospholipase A2 enzymes in their action.
25132377 expression of PLA2s-IIE and -V correlates with the development of calcification as well as the expression of pro-osteogenic molecules in human aortic valves
25069533 sPLA2-V plays a thrombogenic role by impairing the ability of EPCR to promote protein C activation.
24959594 Our results demonstrate the association of the PLA2G5 rs11573191 polymorphism with premature CAD. In our study, it was possible to distinguish one haplotype associated with increased risk of premature CAD and hypertension.
24563418 There is no association between rs525380 polymorphism of PLA2G5 and coronary heart disease.
24495480 results demonstrate that EPCR is overexpressed and mediates the aggressive behavior of rheumatoid synovial fibroblasts, and is likely driven by group V secretory phospholipase A2
24042857 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillindependent pathway.
23650617 Our studies identified a unique function of gV-sPLA2 in activation of macrophages
22137173 Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina
22041135 The effects of acidic pH on the activity of recombinant human group V secreted phospholipase A(2) (sPLA(2)-V) toward small VLDL (sVLDL), IDL, and LDL, on the binding of these apoB-100-containing lipoproteins to human aortic proteoglycans, were examined.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20448053 Group V phospholipase A2 mediates barrier disruption of human pulmonary endothelial cells caused by LPS in vitro
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17545304 Observational study of gene-disease association. (HuGE Navigator)
17545304 PLA2G5 tSNP haplotypes demonstrate an association with total and LDL cholesterol and oxLDL/LDL.
16785555 Group V phospholipase A2, endogenously secreted from activated epithelial cells, promotes secretion of leukotriene C4 from cocultured eosinophils.
16476735 group V PLA2 released from neighboring cells may function in triggering the activation of inflammatory cells under physiological conditions
16146426 present results raise the possibility that group V and X sPLA2s may play a role in innate immunity against adenoviral infection in the respiratory tract
16115226 Group V sPLA2 was expressed in ischaemic cardiomyocytes around the lesion, while no expression was observed in normal heart.
16040605 foam cell formation is promoted by a SR-A- and CD36-independent process that involves cellular proteoglycans and Group V secretory phospholipase A2-modified low density lipoprotein
15377291 sPLA2-V expression in hepatocytes is induced by viral infection, fibrosis, and circulatory disturbance. Immunostaining using sPLA2-V antibody is useful for the detection of injured hepatocytes in patients with liver diseases.
12796497 group V phospholipase A2 induces group IVA phospholipase A2-independent cysteinyl leukotriene synthesis in human eosinophils
12423354 stimulation of three isoforms of PLA2 by thapsigargin liberates free AA that, in turn, induces capacitative calcium influx in human T-cells
12124392 PLA2G5 binds to PLA2G4 to induce leukotriene synthesis in neutrophils
11741884 circulating human neutrophils express groups V and X sPLA(2) (GV and GX sPLA(2)) mRNA and contain GV and GX sPLA(2) proteins, whereas GIB, GIIA, GIID, GIIE, GIIF, GIII, and GXII sPLA(2)s are undetectable
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHC      1 - 70
YGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS       71 - 138
//

Text Mined References (45)

PMID Year Title
25549071 2015 Phospholipase A2 group v in benign familial fleck retina in a set of triplets.
25247183 2014 The step further to understand the role of cytosolic phospholipase A2 alpha and group X secretory phospholipase A2 in allergic inflammation: pilot study.
25132377 2014 The expression of groups IIE and V phospholipase A2 is associated with an increased expression of osteogenic molecules in human calcified aortic valves.
25069533 2014 Group V secretory phospholipase A2 impairs endothelial protein C receptor-dependent protein C activation and accelerates thrombosis in vivo.
24959594 2014 The (G>A) rs11573191 polymorphism of PLA2G5 gene is associated with premature coronary artery disease in the Mexican Mestizo population: the genetics of atherosclerotic disease Mexican study.
24563418 2014 Novel genetic approach to investigate the role of plasma secretory phospholipase A2 (sPLA2)-V isoenzyme in coronary heart disease: modified Mendelian randomization analysis using PLA2G5 expression levels.
24495480 2014 Endothelial protein C receptor-associated invasiveness of rheumatoid synovial fibroblasts is likely driven by group V secretory phospholipase A2.
24042857 2013 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillin?dependent pathway.
23650617 2013 Group V secretory phospholipase A2 is involved in macrophage activation and is sufficient for macrophage effector functions in allergic pulmonary inflammation.
22837859 Group V phospholipase A(2) increases pulmonary endothelial permeability through direct hydrolysis of the cell membrane.
22137173 2011 Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina.
22041135 2012 Acidity and lipolysis by group V secreted phospholipase A(2) strongly increase the binding of apoB-100-containing lipoproteins to human aortic proteoglycans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20448053 2011 Group V phospholipase A2 mediates barrier disruption of human pulmonary endothelial cells caused by LPS in vitro.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17545304 2007 Tagging SNP haplotype analysis of the secretory PLA2-V gene, PLA2G5, shows strong association with LDL and oxLDL levels, suggesting functional distinction from sPLA2-IIA: results from the UDACS study.
16794232 2006 Inflammation and atherosclerosis: Group IIa and Group V sPLA2 are not redundant.
16785555 2006 Transcellular secretion of group V phospholipase A2 from epithelium induces beta 2-integrin-mediated adhesion and synthesis of leukotriene C4 in eosinophils.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16601231 2006 Secretory phospholipase A2 group V: lesion distribution, activation by arterial proteoglycans, and induction in aorta by a Western diet.
16476735 2006 Systematic evaluation of transcellular activities of secretory phospholipases A2. High activity of group V phospholipases A2 to induce eicosanoid biosynthesis in neighboring inflammatory cells.
16146426 2006 Group V and X secretory phospholipase A2 prevents adenoviral infection in mammalian cells.
16115226 2005 Expression of type V secretory phospholipase A in myocardial remodelling after infarction.
16040605 2005 Group V secretory phospholipase A2-modified low density lipoprotein promotes foam cell formation by a SR-A- and CD36-independent process that involves cellular proteoglycans.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15377291 2004 Distribution of type V secretory phospholipase A2 expression in human hepatocytes damaged by liver disease.
15259375 2004 Presence of secretory group IIa and V phospholipase A2 and cytosolic group IValpha phospholipase A2 in chondrocytes from patients with rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963740 2003 Localization of group V phospholipase A2 in caveolin-enriched granules in activated P388D1 macrophage-like cells.
12796497 2003 Human group V phospholipase A2 induces group IVA phospholipase A2-independent cysteinyl leukotriene synthesis in human eosinophils.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12423354 2002 Role of three isoforms of phospholipase A2 in capacitative calcium influx in human T-cells.
12124392 2002 Group V phospholipase A2 induces leukotriene biosynthesis in human neutrophils through the activation of group IVA phospholipase A2.
11741884 2002 Groups IV, V, and X phospholipases A2s in human neutrophils: role in eicosanoid production and gram-negative bacterial phospholipid hydrolysis.
11522612 2001 VEGF stimulation of endothelial cell PAF synthesis is mediated by group V 14 kDa secretory phospholipase A2.
11080676 2000 Structure, function, and regulation of group V phospholipase A(2).
10873151 2000 Cell-specific expression of group X and group V secretory phospholipases A(2) in human lung airway epithelial cells.
10839997 2000 The molecular basis of phosphatidylcholine preference of human group-V phospholipase A2.
10751642 2000 Expression of cytosolic and secreted forms of phospholipase A(2) and cyclooxygenases in human placenta, fetal membranes, and chorionic cell lines.
10531350 1999 Low molecular weight group IIA and group V phospholipase A(2) enzymes have different intracellular locations in mouse bone marrow-derived mast cells.
9767110 1998 Expression and characterization of human group V phospholipase A2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838795 1996 Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.
8300559 1994 Cloning and recombinant expression of a novel human low molecular weight Ca(2+)-dependent phospholipase A2.