Property Summary

NCBI Gene PubMed Count 32
PubMed Score 20.56
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -1.434 2.1e-02
ependymoma -1.200 9.8e-06
glioblastoma -2.000 3.7e-04
sonic hedgehog group medulloblastoma -2.800 2.8e-09
astrocytoma 1.100 3.7e-02
atypical teratoid / rhabdoid tumor -2.500 1.7e-07
medulloblastoma, large-cell -2.500 1.7e-05
primitive neuroectodermal tumor -1.600 5.9e-05
pancreatic ductal adenocarcinoma liver m... 1.194 1.1e-02
non-small cell lung cancer -1.676 1.7e-16
intraductal papillary-mucinous adenoma (... -1.500 2.1e-04
colon cancer -1.200 2.7e-03
diabetes mellitus -1.300 2.4e-03
Breast cancer -2.700 3.1e-02
interstitial cystitis 1.200 2.4e-02
pediatric high grade glioma -1.700 3.2e-05
lung adenocarcinoma -1.327 5.8e-07
Pick disease -1.100 2.4e-06
pituitary cancer 1.800 1.4e-05

Gene RIF (26)

PMID Text
26160611 Results demonstrated no significant impact of PLA2G6 and PLA2G4C gene polymorphisms on attenuated niacin skin flushing in schizophrenia patients.
23025307 HIV-1 Tat upregulates phospholipase A2, group IVC (PLA2G4C) expression in Jurkat T-cells
22878031 site-specific cytosine methylation of the CpT of PLA2G4C may play a role in the pathogenesis of schizophrenia.
22108055 These findings suggest that IVC-PLA(2) is involved in regulations of macrophage differentiation and macrophage polarization.
21600875 these results suggest that cPLA(2)gamma plays an important role in cancer cell chemotaxis.
21184677 Findings suggest that variation in PLA2G4C may influence preterm birth risk by increasing levels of prostaglandins, which are known to regulate labor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452986 cPLA(2) has a role in the induction of cell autonomous cellular immunity to Chlamydia
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20016400 locus showed a weak association with schizophrenia in a Chinese population
19913121 Observational study of gene-disease association. (HuGE Navigator)
19501189 The subcellular localization and enzymatic properties of cPLA2gamma with C-terminal FLAG-tag, was examined.
18686860 Observational study of gene-disease association. (HuGE Navigator)
17459165 endometrial cell PGE2 biosynthesis was associated with PLA2G4C expression and activity
17417066 Single nucleotide polymorphism is asociated with schizzophrenia in a Chinese population.
17213206 iPLA2gamma has roles in the lipid plasticity of myocardium, in generating signaling metabolites, and in modulating energy storage and utilization in myocardium in different metabolic contexts
16882668 Caspase-3-dependent activation of calcium-independent phospholipase A2 enhances cell migration in non-apoptotic ovarian cancer cells
16181776 Observational study of gene-disease association. (HuGE Navigator)
15944408 results indicate that complete C-terminal processing is important for the functional expression of cPLA2, although not for its membrane localization
15908428 identification of its remarkable substrate selectivity that results in the highly selective generation of 2-arachidonoyl lysophosphatidylcholine
15788676 Down-regulation of Phospholipase A2 is associated with colon tumorigenesis
12396716 TNF-alpha & IFN-gamma induce gene expression of a novel cytosolic PLA(2) IVC in human airway epithelial cells. The possibility that it is involved in cytokine-mediated inflammation in the respiratory tract is inferred.
12039969 enzymatic properties
11958371 Novel PLA2G4C polymorphism as a molecular diagnostic A minisatellite polymorphism in the untranslated region of exon 1, with allelic variants that have one, two or three 27-bp repeats
9745929 HIV-1 Tat upregulates phospholipase A2, group IVC (PLA2G4C) expression in Jurkat T-cells
9377118 HIV-1 Tat upregulates phospholipase A2, group IVC (PLA2G4C) expression in Jurkat T-cells

AA Sequence

MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACLGVLSEMKEQG      1 - 70
LLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSLQKTIQAARSENYSLTDFWAY     71 - 140
MVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQPSWQEARAPETWFEFTPHHAGFSALGAFVS    141 - 210
ITHFGSKFKKGRLVRTHPERDLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLI    211 - 280
FARLLRLQESSQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGI    281 - 350
CASKWEWGTTHNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET    351 - 420
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFK    421 - 490
LADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCLA                       491 - 541
//

Text Mined References (36)

PMID Year Title
26160611 2015 Polymorphisms in PLA2G6 and PLA2G4C genes for calcium-independent phospholipase A2 do not contribute to attenuated niacin skin flush response in schizophrenia patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22878031 2012 The DNA methylation profile of PLA2G4C gene promoter in schizophrenia.
22108055 2011 Regulation of macrophage differentiation and polarization by group IVC phospholipase A?.
21600875 2011 Downregulation of cPLA2? expression inhibits EGF-induced chemotaxis of human breast cancer cells through Akt pathway.
21184677 2010 Primate-specific evolution of noncoding element insertion into PLA2G4C and human preterm birth.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20452986 2010 cPLA2 regulates the expression of type I interferons and intracellular immunity to Chlamydia trachomatis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20016400 2010 Lack of genetic association of the PLA2G4C locus with schizophrenia in case-control samples.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19501189 2009 Subcellular localization and lysophospholipase/transacylation activities of human group IVC phospholipase A2 (cPLA2gamma).
18686860 2008 [Study on the genetic association between the polymorphism of cytosolic phospholipase A2 family genes and schizophrenia].
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17459165 2007 Distinct phospholipase A2 enzymes regulate prostaglandin E2 and F2alpha production by bovine endometrial epithelial cells.
17417066 2007 A case-control study of genetic association of the PLA2G4A gene with schizophrenia in a Chinese population.
17213206 2007 Dramatic accumulation of triglycerides and precipitation of cardiac hemodynamic dysfunction during brief caloric restriction in transgenic myocardium expressing human calcium-independent phospholipase A2gamma.
16882668 2006 Caspase-3-dependent activation of calcium-independent phospholipase A2 enhances cell migration in non-apoptotic ovarian cancer cells.
16181776 2005 A study of the combined effect of the CLDN5 locus and the genes for the phospholipid metabolism pathway in schizophrenia.
15944408 2005 Roles of C-terminal processing, and involvement in transacylation reaction of human group IVC phospholipase A2 (cPLA2gamma).
15908428 2005 The highly selective production of 2-arachidonoyl lysophosphatidylcholine catalyzed by purified calcium-independent phospholipase A2gamma: identification of a novel enzymatic mediator for the generation of a key branch point intermediate in eicosanoid signaling.
15788676 2005 Cytoplasmic phospholipase A2 levels correlate with apoptosis in human colon tumorigenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14529291 2003 Purification of recombinant human cPLA2 gamma and identification of C-terminal farnesylation, proteolytic processing, and carboxymethylation by MALDI-TOF-TOF analysis.
12502717 2003 Human group IVC phospholipase A2 (cPLA2gamma). Roles in the membrane remodeling and activation induced by oxidative stress.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12396716 2002 Increased gene expression of novel cytosolic and secretory phospholipase A(2) types in human airway epithelial cells induced by tumor necrosis factor-alpha and IFN-gamma.
12039969 2002 Enzymatic properties of human cytosolic phospholipase A(2)gamma.
11958371 2002 Novel PLA2G4C polymorphism as a molecular diagnostic assay for 19q loss in human gliomas.
10708517 2000 A transcript map of the chromosome 19q-arm glioma tumor suppressor region.
10085124 1999 Molecular cloning of two new human paralogs of 85-kDa cytosolic phospholipase A2.
9705332 1998 A novel calcium-independent phospholipase A2, cPLA2-gamma, that is prenylated and contains homology to cPLA2.
9202034 1997 P11, a unique member of the S100 family of calcium-binding proteins, interacts with and inhibits the activity of the 85-kDa cytosolic phospholipase A2.