Property Summary

NCBI Gene PubMed Count 172
PubMed Score 492.29
PubTator Score 587.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
pancreatic cancer 1.100 2.8e-03
malignant mesothelioma -8.400 2.3e-10
posterior fossa group B ependymoma 2.100 6.2e-05
glioblastoma 1.300 9.7e-03
cystic fibrosis 2.198 9.1e-06
atypical teratoid / rhabdoid tumor -2.400 1.6e-05
group 4 medulloblastoma -1.800 5.0e-03
medulloblastoma, large-cell -2.300 8.3e-04
adrenocortical adenoma -2.614 1.3e-06
adrenocortical carcinoma -3.562 3.4e-07
tuberculosis and treatment for 3 months -1.100 2.9e-02
colon cancer -1.200 7.1e-03
active Crohn's disease -2.292 3.4e-02
breast carcinoma -1.200 8.2e-05
interstitial cystitis -1.400 1.2e-03
pediatric high grade glioma 1.100 2.9e-02
pancreatic carcinoma 1.100 2.8e-03
nasopharyngeal carcinoma 1.100 4.7e-02
lung adenocarcinoma 1.378 1.3e-02
Breast cancer -2.600 1.1e-11
ductal carcinoma in situ -1.900 9.2e-05
invasive ductal carcinoma -1.600 1.7e-02
ovarian cancer -3.200 2.8e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (145)

PMID Text
26525102 genetic association study in Quebec City population: Data suggest total plasma n-6 fatty acid phospholipid levels and C-reactive protein are modulated by SNPs in PLA2G4A and PLA2G6 alone or in combination with fish oil dietary supplementation.
26416244 cPLA2alpha plays an important role in cell cycle re-entry by quiescent prostate cancer cells
26303530 The study reports the formation of a multiprotein complex at the G2-to-M transition in vitro and in vivo. Group IVA cytosolic phospholipase A2 (cPLA2-alpha) acts as a bridge in this complex to promote binding of SIRT2 to cyclin A-Cdk2.
26183771 These studies constitute a definitive account, demonstrating the fundamental role of cPLA2alpha to eicosanoid formation and cellular responses within the human circulation.
25969996 Thymocyte maturation can occur independently of cPLA2-alpha.
25904158 Letter: report instability of cytosolic phospholipase A2alpha variant resulting in severe impairment in platelet arachidonic acid metabolism.
25761116 alphaSN triggered synapse damage via hyperactivation of cPLA2
25617738 Suggest retinal pigment epithelium metabolism of 7-ketocholesterol occurs by esterification to fatty acids via cPLA2alpha and SOAT1 followed by selective efflux to HDL.
25365190 We conclude that cPLA2alpha is required for sustaining AKT phosphorylation at Ser473 and cell proliferation in colorectal cancer cells with PI3K mutation
25102815 Case Report/Twin Study: syndromic form of deficiency of cPLA2a , characterised by recurrent GI ulcers and bleeding diathesis, associated with mild inherited deficiency of factor XI.
25102418 Data indicate 3-(1-Aryl-1H-indol-5-yl)propanoic acids a potent inhibitor of cytosolic phospholipase A2alpha (cPLA2alpha).
24721622 EGF stimulates platelet-activating factor production in ovarian cancer cells in a manner that requires cPLA2.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of phospholipase A2, group IVA (PLA2G4A) in primary human brain microvascular endothelial cells
24366870 LMW HA was a potent stimulant of AA release in a time- and dose-dependent manner, induced cPLA2alpha, ERK1/2, p38, and JNK phosphorylation, as well as activated COX2 expression and prostaglandin (PG) E2 production
24349530 cPLA2alpha appears to be an important regulator of central effectors of inflammation and joint destruction, namely MMP3, IL8, COX2, and PGE2.
23948114 Phospholipase A2 expression in coronary thrombus is associated with recurrence of cardiac events.
23801329 LacCer is a direct activator of cPLA2alpha.
23549331 data provide new and important contributions to the understanding of cPLA2alpha regulation at the transcriptional level, with implications for eicosanoid metabolism, cellular signaling, and disease pathogenesis
23307260 PLA2G4A might serve as a promising target for future therapeutic approaches to gastric cancer combined with COX-2 inhibitors.
23268370 Mutations in PLA2G4A were identified as a cause of cryptogenic multifocal ulcerating stenosing enteritis in two affected siblings.
23219238 Data detected statistically significant but weak impact of PLA2G4A and PTGS2 gene polymorphisms on niacin flush response in schizophrenia patients.
23043861 results suggest that C2-di-ethyl-ceramide-1-phosphate appeared to inhibit cPLA(2)alpha, probably by interaction with a site in the catalytic domain of the enzyme.
22911431 study identified the MAPK/ERK regulated, cytosolic, calcium-dependent PLA2G4A as a novel hepatitis C virus dependency factor; inhibition of PLA2G4A activity reduced core protein abundance at lipid droplets, core envelopment and secretion of particles
22895089 The presence of a terminal sialic acid moiety, a rare modification of mammalian glycosylphosphatidylinositol anchors, was essential in the activation of cytosolic phospholipase A2 and synapse damage induced by cross-linked PrPc.
22728329 the regulation of HT-29 proliferation is mediated by cPLA(2)alpha-dependent PGE(2) production. PGE(2)via EP induces CREB phosphorylation by the PKA pathway and regulates beta-catenin and cyclin D1 cellular localization by PKB/Akt pathway.
22648535 The molecular and biological evidence of the involvement of cPLA2s in the pathogenesis of Alzheimer's disease, is reviewed.
22456504 the lipid modifier cPLA2alpha and EHD1 are involved in the vesiculation of CD59-containing endosomes
22398721 A VE-cadherin-PAR3-alpha-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)alpha in endothelial cells.
22378731 genetic association studies in populations in Costa Rica: An SNP in PLA2G4A (rs12746200) is associated with myocardial infarction; this association is modulated by dietary factors (i.e., omega-6 fatty acid intake).
22274867 Immunohistochemical expressions of cPLA(2)alpha in 23 species of human non-small lung cancer and 5 species of human normal lung to assess their clinicopathological relevance.
22138395 these results illustrated that cPLA(2)alpha-mediated actin filament rearrangements downstream of Akt activation is required for C. sakazakii invasion into brain endothelial cells.
22003202 A cPLA2-initiated lipid mediator pathway induces autophagy in a murine macrophage cell line and in human primary monocytes.
21896865 findings indicate that cPLA2 in the lens epithelial cells is regulated by calcium mobilization and mitogen-activated protein kinases (MAPK) activation; both PDGF mitogenic action and calcium signaling are cPLA(2)alpha-dependent
21862584 Mutation of HuR Thr-118 reduced the association between HuR and cPLA(2)alpha mRNA under IL-1beta treatment
21825068 These findings demonstrate that specific host factors involving cPLAalpha and cysteinyl LTs contribute to type III GBS penetration of the blood-brain barrier and their contribution involves PKCalpha.
21771656 cPLA(2)alpha gene activation by IL-1beta is dependent on an upstream kinase pathway, enzymatic activation and downstream 15-lipoxygenase activity: a positive feedback loop
21536681 cPLA(2)-dependent AA release is required for VEGF-induced Src-PLD1-PKCgamma-mediated pathological retinal angiogenesis
21478406 data suggest that lipin-1 associates with lipid droplets and regulates the activation of cytosolic group IVA phospholipase A(2)alpha in monocyte-derived macrophages
21315000 There is a possible relation between Leptin release and cPLA 2 activity in inflammatory cells induced by LPS.
21268080 Results demonstrated that cigarette smoke extract-induced cPLA(2) expression was mediated through NOX2-dependent p42/p44 MAPK and p38 MAPK/c-Fos and JNK1/2/c-Jun/p300 pathways in HTSMCs.
21247147 results show that the S111P mutation of cPLAhampers calcium binding and membrane translocation without affecting the catalytic activity.
21198294 There were relatively more cPLA2alpha positive tumors, as defined by positive staining in >10% of tumor cells 24 of 76 tumors (32%).
21185392 Results suggest that low magnitude stretch can induce cPLA(2) phosphorylation through the MEK/ERK and PI3K-Akt pathways, independently.
21148506 Cellular invasion was shown to require activation of host cytosolic phospholipase A2 (cPLA2alpha) by Loops1 and 2 but not 3 of Escherichia coli OmpA.
21127289 Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2alpha differently for cyclooxygenase-1 and 12-lipoxygenase catalysis.
21097525 cytoplasmic phospholipase A(2)alpha is required for mediating P. aeruginosa-induced production of certain eicosanoids such as PGE2. However, neutrophil transepithelial migration induced by P. aeruginosa does not require cytoplasmic phospholipase A(2)alpha
20808133 There was no significant correlation between IFN-gamma or cPLA2 genotypes and AD
20808133 Observational study of gene-disease association. (HuGE Navigator)
20802406 These preliminary data might suggest an influence of cPLA2alpha on GM-CSF gene expression in human lung cells.
20705608 Studies help determine the regulation and function of the cPLA(2) family members.
20643646 C. albicans engages both beta-glucan and mannan-binding receptors on macrophages that act with MyD88 to regulate the activation of cPLA(2)alpha and eicosanoid production.
20635443 The study shows that cPLA2 and mPGES-1, in addition to COX-2, are constitutively overexpressed, and that 15-PGDH might be attenuated in colorectal cancer. Furthermore, cPLA2 and 15-PGDH as well as COX-2 could have an important role in tumor progression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20478385 Differential patterns in first-episode vs. chronic patients might be related to PLA(2)-increase at disease onset.
20464283 data suggest that the BanI cPLA2 polymorphism may play a role in the susceptibility for late-onset Alzheimer disease a Brazilian sample.
20435073 Data show that glycation end products (AGE) increase PIP2 production, arachidonic acid release and reactive oxygen species via cytosolic phospholipase A2 activation, and inhibit Na+ K+ ATPase surface expression via PIP5Kgamma.
20392485 higher expression in PBMCs of asthma patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20227521 Decrease in expression or activity of cytosolic phospholipase A2alpha increases cyclooxygenase-1 action: A cross-talk between key enzymes in arachidonic acid pathway in prostate cancer cells.
20211985 The study reports the first evidence for a correlation between cPLA(2)alpha enzymatic activity and overexpression of the HER2 receptor.
20203101 Cortisol activates the cAMP/protein kinase A/CREB-1 pathway via Galpha(s) induction, and the phosphorylated CREB-1 interacts with GR at the GRE to promote cPLA(2alpha) expression in amnion fibroblasts.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20112044 Data show that inhibition of cPLA(2)alpha activity with specific inhibitors blocked growth factor-induced membrane and actin dynamics, suggesting an important role for cPLA(2)alpha in these processes.
20069553 These results suggest that in human tracheal smooth muscle cells, activation of MAPKs, NF-kappaB, and p300 are essential for IL-1beta-induced cPLA(2) expression and PGE(2) secretion.
20066429 These results provide in vivo evidence for increased expression and activation of cPLA2 in motor neurons, reactive astrocytes, and activated microglia in amyotrophic lateral sclerosis
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20034614 Genetic variations in the COX2 and PLA2 genes increase the risk of IFN-alpha-induced depression, possibly by affecting the levels of eicosapentaenoic acid and docosahexaenoic acid .
20034614 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19795129 The cPLA ( 2 )alpha gene may be a possible disease modifier gene in familial adenomatous polyposis.
19778898 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2
19753100 These findings identify cPLA(2)alpha as the first component of the machinery that is responsible for the formation of intercisternal tubular continuities and support a role for these continuities in transport through the Golgi complex.
19717620 The polybasic cluster of cPLA(2)alpha (Lys(488)/Lys(541)/Lys(543)/Lys(544)) regulates the subcellular localization of the enzyme in intact cells under physiologically relevant conditions.
19675210 Data show that the redistribution of cPLA2alpha from the cytoplasm to the Golgi correlates with adherens junction maturation and occurs before tight junction formation.
19632995 Study provides a paradigm shift in how cPLA(2)alpha is activated during inflammation.
19625654 Phosphorylation of cPLA2-alpha on serine505 by c-Jun N-terminal kinase (JNK) mitogen-activated protein kinases is an important step for the proper binding of the enzyme to phagosomal membranes in an active manner in human macrophages.
19560328 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19401382 TLR2 mediates augmented cPLA(2) activation and subsequent leukotriene biosynthesis.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19280714 Cigarette smoke extract induces cytosolic expression via NADPH oxidase, MAPKs, AP-1, and NF-kappaB in human tracheal smooth muscle cells
19237603 Cytosolic phospholipase A(2) (cPLA(2)) is identified as a central molecule in NKG2D-mediated cytolysis in cytotoxic T lymphocytes.
19176526 Ser-505 phosphorylation and basic residues in the catalytic domain principally act to regulate cPLA(2)alpha hydrolytic activity
19091957 Cytosolic phospholipase A2-alpha is an early apoptotic activator in PEDF-induced endothelial cell apoptosis.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18840708 cPLA2 and IIbbeta3 interact to reinforce each other's functions during IIbbeta3 signaling.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18686860 Many loci in the cPLA2 family genes were associated with schizophrenic.
18665843 the inhibition of cPLA(2)alpha activity affected many of the allergen-dependent, asthma-associated gene expression changes.
18632668 a role of cPLA(2)alpha in the formation of nascent lipid droplets from the endoplasmic reticulum
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18566601 Data show that activation of cytosolic phospholipase A(2) and production of lysophosphatidylcholine are initial events required for radiation-induced activation of Akt and ERK1/2 in vascular endothelial cells.
18562188 BanI polymorphism of PLA2G4A showed a significant impact on mean age of the onset of schizophrenia and schizoaffective disorder in males, indicating lower mean age at admission in homozygous A2A2 males.
18562188 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18502815 Cytosolic phospholipase A2alpha activation induced by S1P is mediated by the S1P3 receptor in lung epithelial cells.(
18471798 Genome-wide association study of gene-disease association. (HuGE Navigator)
18451993 human cPLA(2alpha) deficiency is associated with impaired eicosanoid biosynthesis, small intestinal ulceration, and platelet dysfunctio
18388244 Role of cPLA2-alpha in the early action of TCDD through a nongenomic pathway in MCF10A cells is reported.
18280113 The mutation of Ser515 to Ala (S515A) did not change cPLA(2)alpha activity, although S228A and S505A completely and partially decreased the activity, respectively.
17976189 cytosolic phospholipase A2 and leukotriene B4 may have roles in acute myeloid leukemia
17971499 Cell surface ANXA1 synthesis is capable of blocking beta 2-integrin adhesion in PMNs. Fluticasone propionate does not cause ANXA1 synthesis or nuclear transport of cytosolic gIVaPLA2 & thus does not block beta2-integrin adhesion.
17901074 This study showed that cortisol increased PLA2G4A mRNA level via GR-dependent ongoing transcription in human amnion fibroblasts by activating the binding of GR to PLA2G4A promoter directly.
17873281 the confluence-dependent interaction of cPLA(2)alpha and annexin A1 at the Golgi acts as a novel molecular switch controlling cPLA(2)alpha activity and endothelial cell prostaglandin generation.
17685590 Residues specific for binding arachidonic and palmitic acids, preferred substrates for cPLA2 and PLB1, respectively, are identified. These results explan the differences in substrate specificity between lipases sharing the cPLA2 catalytic domain fold.
17672871 Observational study of gene-disease association. (HuGE Navigator)
17629734 Observational study of gene-disease association. (HuGE Navigator)
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17417066 Observational study of gene-disease association. (HuGE Navigator)
17344094 The data presented link the stimulation of ERK-cPLA(2)-15-LO pathway by oxidized LDL to the prooxidant mechanism of the lipoprotein complex.
17178883 PPARdelta induces COX-2 expression and the COX-2-derived PGE(2) further activates PPARdelta via cPLA(2)alpha. which forms a growth-promoting signaling that may play a role in hepatocarcinogenesis.
16963226 Our data suggest that PKCalpha, but not PKCbeta, is the predominant cPKC isoenzyme required for cPLA(2) protein phosphorylation and maximal induction of cPLA(2) enzymatic activity upon activation of human monocytes.
16829784 Observational study of gene-disease association. (HuGE Navigator)
16754327 This review summarizes the phenotypes resulting from genetic ablation of cPLA2alpha, and the properties of newly discovered enzymes in the cPLA2 family.
16603549 cytosolic and group IIA secreted phospholipases A(2) work together to liberate arachidonate from phospholipids in response to cytokines
16585943 This study reviews the evidence and discusses the potential roles of phospholipase A2 Group 4A for schizophrenia with particular emphasis on published association studies.
16409471 HCy led to the phosphorylation of cytosolic phospholipase A2; HCy promoted cPLA2 activation; cPLA2 phosphorylation and activation required p38 MAPK
16407173 These results suggest that early cell death events promoted by an overload of calcium can be prevented by the activity of cytosolic Group IVA phospholipase A(2)alpha.
16221889 phosphatidylinositol 4,5-bisphosphate [PtdIns(4,5)P2] promotes translocation of cPLA2alpha to perinuclear membranes of intact cells in a manner that is independent of rises in the intracellular Ca2+ concentration
16181776 Observational study of gene-disease association. (HuGE Navigator)
15975962 Increased cPLA(2)alpha activity is associated with colon cancer
15789617 Group X secretory phospholipase A2 induces potent arachidonic acid release without activation of cPLA2a.
15475363 cPLA(2)-alpha has a role in the regulation of neutrophil-mediated bacterial killing and the innate immune response to bacterial infection
15358156 Results suggest that a protein kinase C delta-reactive oxygen species-NF-kappaB cascade plays a pivotal role in cytosolic phospholipase A(2)alpha induction by phorbol 12-myristate 13-acetate.
15331599 cPLA2 has an influence on IL-8 and COX 2 gene and protein expression at least in part through PPAR-gamma
15318030 Observational study of gene-disease association. (HuGE Navigator)
15276701 Observational study of gene-disease association. (HuGE Navigator)
15259375 The IValpha cytosolic phospholipase A2 at protein levels in articular cartilage from patients with rheumatoid arthritis, osteoarthritis and patients with non-arthritic joints.
15118355 Observational study of gene-disease association. (HuGE Navigator)
15041036 SNP4 located in the 5'-flanking region of the PLA2G4A gene was associated with schizophrenia
15007070 Stable expression of human groups IIA and X secreted phospholipases A(2) (hGIIA and hGX) in CHO-K1 and HEK293 cells leads to serum- and interleukin-1beta-promoted arachidonate release.
14963030 cPLA(2)alpha translocated to forming phagosomes, surrounding the zymosan particle and completely overlapping with early endosome and plasma membrane markers but only partially overlapping with resident endoplasmic reticulum proteins
14769798 cPLA2 has a role in B-Myb-dependent regulation of c-Myc expression
14726390 show that Phospholipase A(2) type IVA is present in red cells as a 90-kDa protein
14686920 novel mechanisms involving accessory proteins at the target membrane play a role in the regulation of cPLA2-alpha
14609334 The proposed model for membrane docking of the C2 domain of cytosolic phospholipase A2 is fully compatible with the biological function of the intact enzyme.
12885780 group IVA cytosolic phospholipase A(2) is activated by phosphorylation
12765847 Observational study of gene-disease association. (HuGE Navigator)
12765847 Polymorphisms in phospholipase A2 gene is associated with type 2 diabetes mellitus
12414998 Nuclear localisation was dependent on proliferation, with subconfluent cells containing higher levels of nuclear cPLA(2)-alpha than contact-inhibited confluent or serum-starved cells.
12124392 PLA2G5 binds to PLA2G4 to induce leukotriene synthesis in neutrophils
12048163 Expressed in human colorectal adenocarcinomas
9745929 Microarray analysis indicates HIV-1 Tat-induced upregulation of phospholipase A2, group IVA (PLA2G4A) in primary human brain microvascular endothelial cells
9377118 Microarray analysis indicates HIV-1 Tat-induced upregulation of phospholipase A2, group IVA (PLA2G4A) in primary human brain microvascular endothelial cells

AA Sequence

MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPV      1 - 70
WNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCS     71 - 140
CPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMK    141 - 210
ALYESGILDCATYVAGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLW    211 - 280
KKKSSGQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFS    281 - 350
PYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE    351 - 420
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVH    421 - 490
NFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPL    491 - 560
ILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDM    561 - 630
EKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFN    631 - 700
TLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA                         701 - 749
//

Text Mined References (180)

PMID Year Title
26525102 2015 Modulation of C-reactive protein and plasma omega-6 fatty acid levels by phospholipase A2 gene polymorphisms following a 6-week supplementation with fish oil.
26416244 2015 Targeting of cytosolic phospholipase A2? impedes cell cycle re-entry of quiescent prostate cancer cells.
26303530 2015 Group IVA Cytosolic Phospholipase A2 Regulates the G2-to-M Transition by Modulating the Activity of Tumor Suppressor SIRT2.
26183771 2015 Inherited human group IVA cytosolic phospholipase A2 deficiency abolishes platelet, endothelial, and leucocyte eicosanoid generation.
25969996 2015 Study of the role of cytosolic phospholipase A2 alpha in eicosanoid generation and thymocyte maturation in the thymus.
25904158 2015 Instability of cytosolic phospholipase A2? variant upon cellular expression as a basis for its clinical presentation.
25761116 2015 ?-Synuclein-induced synapse damage in cultured neurons is mediated by cholesterol-sensitive activation of cytoplasmic phospholipase A2.
25617738 2015 Extra-hepatic metabolism of 7-ketocholesterol occurs by esterification to fatty acids via cPLA2? and SOAT1 followed by selective efflux to HDL.
25365190 2014 Targeting cytosolic phospholipase A2 ? in colorectal cancer cells inhibits constitutively activated protein kinase B (AKT) and cell proliferation.
25102815 2014 Bleeding diathesis and gastro-duodenal ulcers in inherited cytosolic phospholipase-A2 alpha deficiency.
25102418 2014 Design, synthesis, and biological evaluation of 3-(1-Aryl-1H-indol-5-yl)propanoic acids as new indole-based cytosolic phospholipase A2? inhibitors.
24721622 2014 Epidermal growth factor induces platelet-activating factor production through receptors transactivation and cytosolic phospholipase A2 in ovarian cancer cells.
24366870 2014 Low molecular weight hyaluronan activates cytosolic phospholipase A2? and eicosanoid production in monocytes and macrophages.
24349530 2013 Cytosolic phospholipase A2 regulates TNF-induced production of joint destructive effectors in synoviocytes.
23948114 2013 Phospholipase A2 expression in coronary thrombus is increased in patients with recurrent cardiac events after acute myocardial infarction.
23801329 2013 Lactosylceramide interacts with and activates cytosolic phospholipase A2?.
23549331 2013 A distal enhancer controls cytokine-dependent human cPLA2? gene expression.
23307260 2013 Reduced group IVA phospholipase A2 expression is associated with unfavorable outcome for patients with gastric cancer.
23268370 2014 Cryptogenic multifocal ulcerating stenosing enteritis associated with homozygous deletion mutations in cytosolic phospholipase A2-?.
23219238 2013 The impact of PLA2G4A and PTGS2 gene polymorphisms, and red blood cell PUFAs deficit on niacin skin flush response in schizophrenia patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043861 2012 C2-di-ethyl-ceramide-1-phosphate as an inhibitor of group IVA cytosolic phospholipase A2.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22911431 2012 MAP-kinase regulated cytosolic phospholipase A2 activity is essential for production of infectious hepatitis C virus particles.
22895089 Clustering of sialylated glycosylphosphatidylinositol anchors mediates PrP-induced activation of cytoplasmic phospholipase A 2 and synapse damage.
22728329 2012 HT-29 human colon cancer cell proliferation is regulated by cytosolic phospholipase A(2)? dependent PGE(2)via both PKA and PKB pathways.
22648535 2012 Role of cytosolic calcium-dependent phospholipase A2 in Alzheimer's disease pathogenesis.
22456504 2012 cPLA2? and EHD1 interact and regulate the vesiculation of cholesterol-rich, GPI-anchored, protein-containing endosomes.
22398721 2012 A VE-cadherin-PAR3-?-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)? in endothelial cells.
22378731 2012 Association of PLA2G4A with myocardial infarction is modulated by dietary PUFAs.
22274867 2012 Effects of the inhibition of cytosolic phospholipase A(2)? in non-small cell lung cancer cells.
22138395 2012 cPLA2?-mediated actin rearrangements downstream of the Akt signaling is required for Cronobacter sakazakii invasion into brain endothelial cells.
22003202 2011 A cytosolic phospholipase A2-initiated lipid mediator pathway induces autophagy in macrophages.
21896865 2011 Regulation of cytosolic phospholipase A2 (cPLA2alpha) and its association with cell proliferation in human lens epithelial cells.
21862584 2011 The RNA-binding protein HuR stabilizes cytosolic phospholipase A2? mRNA under interleukin-1? treatment in non-small cell lung cancer A549 Cells.
21825068 2011 Host cytosolic phospholipase A?? contributes to group B Streptococcus penetration of the blood-brain barrier.
21771656 2011 cPLA(2)? gene activation by IL-1? is dependent on an upstream kinase pathway, enzymatic activation and downstream 15-lipoxygenase activity: a positive feedback loop.
21536681 2011 Activation of cytosolic phospholipase A2 downstream of the Src-phospholipase D1 (PLD1)-protein kinase C ? (PKC?) signaling axis is required for hypoxia-induced pathological retinal angiogenesis.
21478406 2011 Subcellular localization and role of lipin-1 in human macrophages.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21315000 2011 [Effect of inhibition of cytosolic phospholipase A? on Leptin release from human umbilical vein endothelial cells induced by lipopolysaccharide].
21269460 2011 Initial characterization of the human central proteome.
21268080 2011 Cigarette smoke extract regulates cytosolic phospholipase A2 expression via NADPH oxidase/MAPKs/AP-1 and p300 in human tracheal smooth muscle cells.
21247147 2011 Functional characterization of mutations in inherited human cPLA? deficiency.
21198294 2010 Immunohistochemical expression of cytosolic phospholipase A2? in non-small cell lung carcinoma.
21185392 2011 Mild stretch activates cPLA2 in alveolar type II epithelial cells independently through the MEK/ERK and PI3K pathways.
21148506 2011 Extracellular loops of the Eschericia coli outer membrane protein A contribute to the pathogenesis of meningitis.
21127289 2011 Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2? differently for cyclooxygenase-1 and 12-lipoxygenase catalysis.
21097525 2011 Selective eicosanoid-generating capacity of cytoplasmic phospholipase A2 in Pseudomonas aeruginosa-infected epithelial cells.
20808133 2010 Association study of interferon-?, cytosolic phospholipase A2, and cyclooxygenase-2 gene polymorphisms in Alzheimer disease.
20802406 2010 Cytosolic phospholipase A2 group IVA influence on GM-CSF expression in human lung cells: a pilot study.
20705608 2010 Interfacial kinetic and binding properties of mammalian group IVB phospholipase A2 (cPLA2beta) and comparison with the other cPLA2 isoforms.
20643646 2010 Pathways regulating cytosolic phospholipase A2 activation and eicosanoid production in macrophages by Candida albicans.
20635443 2010 Impacts of cytosolic phospholipase A2, 15-prostaglandin dehydrogenase, and cyclooxygenase-2 expressions on tumor progression in colorectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20478385 2010 Phospholipase A2 activity is associated with structural brain changes in schizophrenia.
20464283 2010 Study of association between genetic polymorphisms of phospholipase A2 enzymes and Alzheimer's disease.
20435073 2010 Advanced glycation end products inhibit Na+ K+ ATPase in proximal tubule epithelial cells: role of cytosolic phospholipase A2alpha and phosphatidylinositol 4-phosphate 5-kinase gamma.
20392485 2010 Cytosolic phospholipase A2 group IVA is overexpressed in patients with persistent asthma and regulated by the promoter microsatellites.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20227521 2010 Decrease in expression or activity of cytosolic phospholipase A2alpha increases cyclooxygenase-1 action: A cross-talk between key enzymes in arachidonic acid pathway in prostate cancer cells.
20211985 2010 Cytosolic phospholipase A2 activation correlates with HER2 overexpression and mediates estrogen-dependent breast cancer cell growth.
20203101 2010 Induction of Galphas contributes to the paradoxical stimulation of cytosolic phospholipase A2alpha expression by cortisol in human amnion fibroblasts.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20112044 2010 Novel role of cPLA(2)alpha in membrane and actin dynamics.
20069553 2010 Activation and induction of cytosolic phospholipase A2 by IL-1beta in human tracheal smooth muscle cells: role of MAPKs/p300 and NF-kappaB.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20066429 2010 Increased expression and activation of cytosolic phospholipase A2 in the spinal cord of patients with sporadic amyotrophic lateral sclerosis.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20034614 2010 Phospholipase A2 and cyclooxygenase 2 genes influence the risk of interferon-alpha-induced depression by regulating polyunsaturated fatty acids levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19795129 2010 Impact of group IVA cytosolic phospholipase A2 gene polymorphisms on phenotypic features of patients with familial adenomatous polyposis.
19778898 2009 JNK and ceramide kinase govern the biogenesis of lipid droplets through activation of group IVA phospholipase A2.
19753100 2009 Group IV phospholipase A(2)alpha controls the formation of inter-cisternal continuities involved in intra-Golgi transport.
19717620 2010 The cationic cluster of group IVA phospholipase A2 (Lys488/Lys541/Lys543/Lys544) is involved in translocation of the enzyme to phagosomes in human macrophages.
19675210 2009 Golgi-associated cPLA2alpha regulates endothelial cell-cell junction integrity by controlling the trafficking of transmembrane junction proteins.
19632995 2009 Ceramide 1-phosphate is required for the translocation of group IVA cytosolic phospholipase A2 and prostaglandin synthesis.
19625654 2009 Requirement of JNK-mediated phosphorylation for translocation of group IVA phospholipase A2 to phagosomes in human macrophages.
19560328 2009 No association between the PPARG gene and schizophrenia in a British population.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19401382 2009 TLR2 ligands augment cPLA2alpha activity and lead to enhanced leukotriene release in human monocytes.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19280714 2009 Cigarette smoke extract induces cytosolic phospholipase A2 expression via NADPH oxidase, MAPKs, AP-1, and NF-kappaB in human tracheal smooth muscle cells.
19237603 2009 Cytosolic PLA2 is required for CTL-mediated immunopathology of celiac disease via NKG2D and IL-15.
19176526 2009 Role of phosphorylation and basic residues in the catalytic domain of cytosolic phospholipase A2alpha in regulating interfacial kinetics and binding and cellular function.
19091957 2009 Cytosolic phospholipase A2-{alpha} is an early apoptotic activator in PEDF-induced endothelial cell apoptosis.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18840708 2009 Group IVA cytosolic phospholipase A2 (cPLA2alpha) and integrin alphaIIbbeta3 reinforce each other's functions during alphaIIbbeta3 signaling in platelets.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18686860 2008 [Study on the genetic association between the polymorphism of cytosolic phospholipase A2 family genes and schizophrenia].
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18665843 2008 In vitro allergen challenge of peripheral blood induces differential gene expression in mononuclear cells of asthmatic patients: inhibition of cytosolic phospholipase A2alpha overcomes the asthma-associated response.
18632668 2008 Group IVA phospholipase A2 is necessary for the biogenesis of lipid droplets.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18566601 2008 Cytosolic phospholipase A2 regulates viability of irradiated vascular endothelium.
18562188 2008 BanI polymorphism of cytosolic phospholipase A2 gene is associated with age at onset in male patients with schizophrenia and schizoaffective disorder.
18502815 2008 Cytosolic phospholipase A2alpha activation induced by S1P is mediated by the S1P3 receptor in lung epithelial cells.
18471798 2008 Genome-wide association scan identifies a prostaglandin-endoperoxide synthase 2 variant involved in risk of knee osteoarthritis.
18451993 2008 Inherited human cPLA(2alpha) deficiency is associated with impaired eicosanoid biosynthesis, small intestinal ulceration, and platelet dysfunction.
18388244 2008 Roles of cytosolic phospholipase A2 and Src kinase in the early action of 2,3,7,8-tetrachlorodibenzo-p-dioxin through a nongenomic pathway in MCF10A cells.
18280113 2008 Ser515 phosphorylation-independent regulation of cytosolic phospholipase A2alpha (cPLA2alpha) by calmodulin-dependent protein kinase: possible interaction with catalytic domain A of cPLA2alpha.
18088087 2008 Phosphoproteome of resting human platelets.
17976189 2007 The expression of cytosolic phospholipase A2 and biosynthesis of leukotriene B4 in acute myeloid leukemia cells.
17971499 2008 Attenuated translocation of group IVa phospholipase A2 and up-regulated annexin-1 synthesis by glucocorticoid blocks beta 2-integrin adhesion in neutrophils.
17901074 2008 Paradox of glucocorticoid-induced cytosolic phospholipase A2 group IVA messenger RNA expression involves glucocorticoid receptor binding to the promoter in human amnion fibroblasts.
17873281 2007 The confluence-dependent interaction of cytosolic phospholipase A2-alpha with annexin A1 regulates endothelial cell prostaglandin E2 generation.
17685590 2007 Role of conserved active site residues in catalysis by phospholipase B1 from Cryptococcus neoformans.
17672871 2007 85-kDa cytosolic phospholipase A2 group IValpha gene promoter polymorphisms in patients with severe asthma: a gene expression and case-control study.
17629734 2007 Association between BanI genotype and increased phospholipase A2 activity in schizophrenia.
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17417066 2007 A case-control study of genetic association of the PLA2G4A gene with schizophrenia in a Chinese population.
17344094 2007 Activation of cytosolic phospholipase A2 and 15-lipoxygenase by oxidized low-density lipoproteins in cultured human lung fibroblasts.
17178883 2006 Cross-talk between peroxisome proliferator-activated receptor delta and cytosolic phospholipase A(2)alpha/cyclooxygenase-2/prostaglandin E(2) signaling pathways in human hepatocellular carcinoma cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16963226 2007 PKCalpha regulates phosphorylation and enzymatic activity of cPLA2 in vitro and in activated human monocytes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16829784 2006 Lack of genetic association between the phospholipase A2 gene and bipolar mood disorder in a European multicentre case-control study.
16754327 Cytosolic phospholipase A2: biochemical properties and physiological roles.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16603549 2006 Intracellular actions of group IIA secreted phospholipase A2 and group IVA cytosolic phospholipase A2 contribute to arachidonic acid release and prostaglandin production in rat gastric mucosal cells and transfected human embryonic kidney cells.
16585943 2006 The role of phospholipases A2 in schizophrenia.
16462602 2006 Hypoxia-sensitive domain in the human cytosolic phospholipase A2 promoter.
16409471 2006 Activation of p38 MAPKinase/cPLA2 pathway in homocysteine-treated platelets.
16407173 2006 Overexpression of cytosolic group IVA phospholipase A2 protects cells from Ca2+-dependent death.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221889 2006 Phosphatidylinositol 4,5-bisphosphate anchors cytosolic group IVA phospholipase A2 to perinuclear membranes and decreases its calcium requirement for translocation in live cells.
16181776 2005 A study of the combined effect of the CLDN5 locus and the genes for the phospholipid metabolism pathway in schizophrenia.
15975962 2005 Activation of cPLA2 is required for leukotriene D4-induced proliferation in colon cancer cells.
15789617 2005 Group X secretory phospholipase A2 can induce arachidonic acid release and eicosanoid production without activation of cytosolic phospholipase A2 alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475363 2005 Cytosolic phospholipase A2-alpha is necessary for platelet-activating factor biosynthesis, efficient neutrophil-mediated bacterial killing, and the innate immune response to pulmonary infection: cPLA2-alpha does not regulate neutrophil NADPH oxidase activity.
15358156 2004 A pathway involving protein kinase Cdelta up-regulates cytosolic phospholipase A(2)alpha in airway epithelium.
15331599 2004 Cytosolic phospholipase A2 Group IValpha but not secreted phospholipase A2 Group IIA, V, or X induces interleukin-8 and cyclooxygenase-2 gene and protein expression through peroxisome proliferator-activated receptors gamma 1 and 2 in human lung cells.
15318030 2004 Allelic association analysis of phospholipase A2 genes with schizophrenia.
15305015 2004 Regulatory mechanism and physiological role of cytosolic phospholipase A2.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15276701 2004 BanI polymorphism of the cytosolic phospholipase A2 gene may confer susceptibility to the development of schizophrenia.
15259375 2004 Presence of secretory group IIa and V phospholipase A2 and cytosolic group IValpha phospholipase A2 in chondrocytes from patients with rheumatoid arthritis.
15118355 2004 BanI polymorphism of the cytosolic phospholipase A2 gene and mood disorders in the Korean population.
15041036 2004 A study of a genetic association between the PTGS2/PLA2G4A locus and schizophrenia.
15007070 2004 Arachidonic acid release from mammalian cells transfected with human groups IIA and X secreted phospholipase A(2) occurs predominantly during the secretory process and with the involvement of cytosolic phospholipase A(2)-alpha.
14963030 2004 Cytosolic phospholipase A2 translocates to forming phagosomes during phagocytosis of zymosan in macrophages.
14769798 2004 B-Myb-dependent regulation of c-Myc expression by cytosolic phospholipase A2.
14726390 2004 Cytosolic phospholipase A2 type IVA is present in human red cells.
14686920 2004 Stimulation-dependent recruitment of cytosolic phospholipase A2-alpha to EA.hy.926 endothelial cell membranes leads to calcium-independent association.
14609334 2003 Membrane-docking loops of the cPLA2 C2 domain: detailed structural analysis of the protein-membrane interface via site-directed spin-labeling.
12885780 2003 Mechanism of group IVA cytosolic phospholipase A(2) activation by phosphorylation.
12765847 2003 Association of a F479L variant in the cytosolic phospholipase A2 gene (PLA2G4A) with decreased glucose turnover and oxidation rates in Pima Indians.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414998 2002 Nuclear localisation of cytosolic phospholipase A2-alpha in the EA.hy.926 human endothelial cell line is proliferation dependent and modulated by phosphorylation.
12124392 2002 Group V phospholipase A2 induces leukotriene biosynthesis in human neutrophils through the activation of group IVA phospholipase A2.
12050227 2002 Phospholipase A(2) and cyclooxygenase gene expression in human preimplantation embryos.
12048163 2002 Expression of cytosolic and group X secretory phospholipase A(2) genes in human colorectal adenocarcinomas.
11416127 2001 PLIP, a novel splice variant of Tip60, interacts with group IV cytosolic phospholipase A(2), induces apoptosis, and potentiates prostaglandin production.
10978317 2000 Serine 727 phosphorylation and activation of cytosolic phospholipase A2 by MNK1-related protein kinases.
10625659 2000 Identification of a cellular protein that functionally interacts with the C2 domain of cytosolic phospholipase A(2)alpha.
10319815 1999 Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
10085124 1999 Molecular cloning of two new human paralogs of 85-kDa cytosolic phospholipase A2.
9875225 1998 Cleavage of human cytosolic phospholipase A2 by caspase-1 (ICE) and caspase-8 (FLICE).
9665851 1998 Solution structure and membrane interactions of the C2 domain of cytosolic phospholipase A2.
9468497 1998 Identification of the phosphorylation sites of cytosolic phospholipase A2 in agonist-stimulated human platelets and HeLa cells.
9430701 1998 Crystal structure of a calcium-phospholipid binding domain from cytosolic phospholipase A2.
9239738 1997 Differential expression of type II, IV and cytosolic PLA2 messenger RNA in human intrauterine tissues at term.
8910365 1996 p38 mitogen-activated protein kinase phosphorylates cytosolic phospholipase A2 (cPLA2) in thrombin-stimulated platelets. Evidence that proline-directed phosphorylation is not required for mobilization of arachidonic acid by cPLA2.
8702602 1996 Identification of essential residues for the catalytic function of 85-kDa cytosolic phospholipase A2. Probing the role of histidine, aspartic acid, cysteine, and arginine.
8636128 1996 Identification of phosphorylation sites of human 85-kDa cytosolic phospholipase A2 expressed in insect cells and present in human monocytes.
8619991 1996 Functional identification of the active-site nucleophile of the human 85-kDa cytosolic phospholipase A2.
8612580 1996 Interferon-alpha-induced phosphorylation and activation of cytosolic phospholipase A2 is required for the formation of interferon-stimulated gene factor three.
8381049 1993 cPLA2 is phosphorylated and activated by MAP kinase.
8175726 1994 Diversity of group types, regulation, and function of phospholipase A2.
8083230 1994 Serine 228 is essential for catalytic activities of 85-kDa cytosolic phospholipase A2.
7999086 1994 5'-flanking region surrounding a human cytosolic phospholipase A2 gene.
7862535 1995 Identification of a 27 bp 5'-flanking region element responsible for the low level constitutive expression of the human cytosolic phospholipase A2 gene.
7800505 1994 Characterization of the promoter for the human 85 kDa cytosolic phospholipase A2 gene.
7782073 1995 Cytosolic phospholipase A2 gene in human and rat: chromosomal localization and polymorphic markers.
1904318 1991 A novel arachidonic acid-selective cytosolic PLA2 contains a Ca(2+)-dependent translocation domain with homology to PKC and GAP.
1869522 1991 Molecular cloning and expression of human Ca(2+)-sensitive cytosolic phospholipase A2.