Property Summary

NCBI Gene PubMed Count 32
PubMed Score 8.37
PubTator Score 12.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-08
psoriasis 6694 3.0e-07
active Crohn's disease 922 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.254 1.7e-02
ovarian cancer 1.100 1.2e-08
psoriasis 1.500 3.0e-07

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQS      1 - 70
CSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARKKRAAGQSGVP     71 - 140
GGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISH    141 - 210
CDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYN    211 - 280
ASWSSRATSPTPSSRSPAPPKPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQG    281 - 350
GLKPQGARWVCRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL    351 - 420
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQC    421 - 490
LQLTQAARRPDRQQKSWSQ                                                       491 - 509
//

Text Mined References (33)

PMID Year Title