Property Summary

NCBI Gene PubMed Count 31
PubMed Score 7.31
PubTator Score 12.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 8.7e-126
ovarian cancer 8491 1.2e-08
active Crohn's disease 918 1.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.200 8.7e-126
active Crohn's disease 1.254 1.7e-02
ovarian cancer 1.100 1.2e-08

 CSPA Cell Line (1)

Gene RIF (20)

PMID Text
25964585 sPLA2GIII expression may be used as a risk factor for lymph node metastasis and a prognostic marker in colorectal cancer. In addition, sPLA2GIII and sPLA2GX may play opposing roles in colorectal carcinogenesis
25286228 Studies indicate that the expression of secreted phospholipases A2 (sPLA2s), most notably the group IIA, III and X enzymes, is dysregulated in various malignant tissues.
25230085 Studies indicate that phospholipase A2 receptor 1 (PLA2R1) may act as a clearance or signaling receptor for secreted phospholipase A2 (sPLA2s).
24508801 Data indicate that the expression of genes encoding hGIIA, hGIII and hGX sPLA2s (PLA2G2A, PLA2G3 and PLA2G10, respectively) in breast tumour biopsies differs from that in normal tissues.
20930276 we describe that PLA2G3 gene silencing produced a marked inhibition of xanthine/xanthine oxidase induced cell death, and that PLA2G3 polymorphisms are associated with Alzheimer disease in a Spanish case-control sample.
20930276 Observational study of gene-disease association. (HuGE Navigator)
20654644 The availability of the human group III phospholipase A(2) (hIIIPLA(2)) amino acid sequence offers an opportunity to study its structural features by modeling.
20492356 Secreted PLA2 III induces apoptosis of primary cortical neurons in culture by suppressing production of Bcl-xl, promoting Bax, augmenting caspase 3 and cleaving alpha-fodrin.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19371233 This study showed that endogenous group III sPLA2 (PLA2G3) is expressed in mouse skin and that transgenic mice overexpressing human PLA2G3 spontaneously develop skin inflammation.
18801741 a potential functional link between PLA2G3 and atherosclerosis, as has recently been proposed for PLA2G5 and PLA2G10.
17980167 the biological action of group III sPLA(2) depends on its N-terminal domain
17868035 potential contribution of sPLA2-III to neuronal differentiation and its function under certain conditions
15863501 sPLA(2)-III may have a role in cancer development by stimulating tumor cell growth and angiogenesis
12522102 cellular arachidonate (AA) release and prostaglandin (PG) production are regulated by novel classes of secretory phospholipase A(2)s (sPLA(2)s), groups III and XII
12127976 Lys 43 and Asp 46 in rhUG are critical residues for the sPLA2-inhibitory activity of UG
9745929 HIV-1 gp120 induces a specific phospholipase A2 (PLA2) activation in lymphocytes through binding to CD4, but this effect is not sufficient to accomplish virus/cell fusion
9377118 HIV-1 gp120 induces a specific phospholipase A2 (PLA2) activation in lymphocytes through binding to CD4, but this effect is not sufficient to accomplish virus/cell fusion

AA Sequence

MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQS      1 - 70
CSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARKKRAAGQSGVP     71 - 140
GGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISH    141 - 210
CDCDTRFQQCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYN    211 - 280
ASWSSRATSPTPSSRSPAPPKPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQG    281 - 350
GLKPQGARWVCRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL    351 - 420
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQC    421 - 490
LQLTQAARRPDRQQKSWSQ                                                       491 - 509
//

Text Mined References (32)

PMID Year Title
25964585 2015 Phospholipase A2 Group III and Group X Have Opposing Associations with Prognosis in Colorectal Cancer.
25286228 2014 Secreted phospholipases A2 in cancer: diverse mechanisms of action.
25230085 2014 Emerging roles of secreted phospholipase A2 enzymes: the 3rd edition.
24692702 2014 Silibinin down-regulates expression of secreted phospholipase A2 enzymes in cancer cells.
24508801 2014 Secreted phospholipases A?are differentially expressed and epigenetically silenced in human breast cancer cells.
23793742 2013 Structural and phylogenetic basis for the classification of group III phospholipase A2.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23685814 2013 PLA2G3 promotes mast cell maturation and function.
23624557 2013 Mast cell maturation is driven via a group III phospholipase A2-prostaglandin D2-DP1 receptor paracrine axis.
21848517 2011 T-cell and antibody responses to phospholipase A2 from different species show distinct cross-reactivity patterns.
21701769 2011 Bee venom phospholipase A2 prevents prion peptide induced-cell death in neuronal cells.
20930276 2010 PLA2G3, a gene involved in oxidative stress induced death, is associated with Alzheimer's disease.
20654644 2010 Human group III PLA2 as a drug target: structural analysis and inhibitor binding studies.
20492356 2010 Hypoxic preconditioning suppresses group III secreted phospholipase A2-induced apoptosis via JAK2-STAT3 activation in cortical neurons.
20393563 2010 Functional genomic screen for modulators of ciliogenesis and cilium length.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19805624 2010 Secretory phospholipase A2 type III enhances alpha-secretase-dependent amyloid precursor protein processing through alterations in membrane fluidity.
19541351 2009 Lung mast cells are a source of secreted phospholipases A2.
19371233 2009 Group III secreted phospholipase A2 transgenic mice spontaneously develop inflammation.
18801741 2008 Analyses of group III secreted phospholipase A2 transgenic mice reveal potential participation of this enzyme in plasma lipoprotein modification, macrophage foam cell formation, and atherosclerosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17980167 2007 Human group III phospholipase A2 suppresses adenovirus infection into host cells. Evidence that group III, V and X phospholipase A2s act on distinct cellular phospholipid molecular species.
17868035 2008 Human group III secreted phospholipase A2 promotes neuronal outgrowth and survival.
15863501 2005 Cellular distribution, post-translational modification, and tumorigenic potential of human group III secreted phospholipase A(2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12522102 2003 Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127976 2002 Lys 43 and Asp 46 in alpha-helix 3 of uteroglobin are essential for its phospholipase A2 inhibitory activity.
10713052 2000 Novel human secreted phospholipase A(2) with homology to the group III bee venom enzyme.
10591208 1999 The DNA sequence of human chromosome 22.