Property Summary

Ligand Count 9
NCBI Gene PubMed Count 6
PubMed Score 1.39
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.0e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.300 4.0e-07

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MKKFFTVAILAGSVLSTAHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCC      1 - 70
YQELFDQGCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVYCQG     71 - 140
PTPNCSIYEPPPEEVTCSHQSPAPPAPP                                              141 - 168
//

Text Mined References (6)

PMID Year Title