Property Summary

NCBI Gene PubMed Count 25
PubMed Score 121.44
PubTator Score 68.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 4.3e-02
interstitial cystitis 1.800 1.6e-02
ovarian cancer 1.100 3.3e-07
psoriasis 2.500 1.7e-22

Protein-protein Interaction (4)

Gene RIF (16)

PMID Text
26392224 found to induce PLA2G2D expression in mice and in human monocyte-derived macrophages
22490726 phospholipid bilayer permeabilization by the hsPLA2GIID is independent of catalytic activity.
22240557 sPLA(2)-IID is present at the head and midpiece in the human sperm, and its activation seems to be involved in acrosomal exocytosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19365107 The Gly80Ser polymorphism may be associated with the body weight loss seen in chronic obstructive pulmonary disease patients. PLA2G2D-Ser enhances the expression of IL-6 and IL-8 compared with PLA2G2D-Gly.
18958346 The distribution pattern of sPLA2S in intact spermatozoa might be an additional parameter for evaluating sperm quality
16897354 lipopolysaccharides inhibit interferon gamma-induced gene expression of secretory phospholipase A2 type IID in human monocyte-derived macrophages
16002569 Observational study of gene-disease association. (HuGE Navigator)
16002569 These results suggest that sPLA2-IID may be one of the susceptibility genes that contribute to body weight loss in patients with COPD.
15379211 overexpression of human secretory phospholipase A2 group IIA leads to an enhanced delivery of cholesterol from phospholipolysed lipoproteins to the liver
15052324 The GIID sPLA2 is clustered on human chromosome 1 and is differentially expressed in tissues, suggesting it has unique function.
12895207 Observational study of gene-disease association. (HuGE Navigator)
12396716 TNF-alpha & IFN-gamma induce gene expression of a novel secretory PLA(2)IIDin human airway epithelial cells. The possibility that it is involved in cytokine-mediated inflammation in the respiratory tract is inferred.
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCC      1 - 70
YDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRG     71 - 140
QTPGC                                                                     141 - 145
//

Text Mined References (27)

PMID Year Title
26392224 2015 Critical role of phospholipase A2 group IID in age-related susceptibility to severe acute respiratory syndrome-CoV infection.
23533611 2013 Assessing phospholipase A2 activity toward cardiolipin by mass spectrometry.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22490726 2012 The bactericidal effect of human secreted group IID phospholipase A2 results from both hydrolytic and non-hydrolytic activities.
22240557 Secretory phospholipase A2 group IID Is involved in progesterone-induced acrosomal exocytosis of human spermatozoa.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19365107 2009 Gly80Ser polymorphism of phospholipase A2-IID is associated with cytokine inducibility in A549 cells.
18958346 2008 Destabilization of acrosome and elastase influence mediate the release of secretory phospholipase A2 from human spermatozoa.
18405237 2008 Biochemistry and physiology of mammalian secreted phospholipases A2.
16897354 2005 Interferon gamma-induced gene expression of the novel secretory phospholipase A2 type IID in human monocyte-derived macrophages is inhibited by lipopolysaccharide.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16188494 2005 Diverse cellular localizations of secretory phospholipase A2 enzymes in several human tissues.
16002569 2005 A novel polymorphism in secretory phospholipase A2-IID is associated with body weight loss in chronic obstructive pulmonary disease.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15379211 2004 Increased hepatic cholesterol accumulation in transgenic mice overexpressing human secretory phospholipase A2 group IIA.
15052324 2004 Regulation of arachidonic acid availability for eicosanoid production.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12895207 2003 Allelic association study between phospholipase A2 genes and bipolar affective disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12396716 2002 Increased gene expression of novel cytosolic and secretory phospholipase A(2) types in human airway epithelial cells induced by tumor necrosis factor-alpha and IFN-gamma.
11196711 2000 SPLASH (PLA2IID), a novel member of phospholipase A2 family, is associated with lymphotoxin deficiency.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10455175 1999 Cloning and characterization of novel mouse and human secretory phospholipase A(2)s.