Property Summary

NCBI Gene PubMed Count 174
PubMed Score 723.71
PubTator Score 1041.29

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

 MGI Phenotype (1)

Gene RIF (139)

PMID Text
26644377 IL-22 induced at an early stage of L. monocytogenes infection enhances innate immunity against L. monocytogenes in the liver by stimulating hepatocytes to produce PLA2G2A
26506412 These results suggest that the genetic ablation of iPLA2b increased iron uptake in the brain through the activation of IRP2 and upregulation of DMT1, which may be associated with mitochondrial dysfunction.
26488172 Overexpression of sPLA2-IIA does not alter MCP-1 level at baseline, but could enhance the atherogenic effect of oxidized LDL in HASMCs, at least partly due to activation of Akt.
26106157 Results indicate that secreted phospholipase A2 IIA (sPLA2-IIA) as an enzyme working in concert with platelet microparticles (MPs) 12-lipoxygenase (12-LO) to promote internalization.
25794429 The minor allele of rs11573156, is a dominant haplotype and is associated with the higher sPLA2-IIa levels.
25713085 Activity of iPLbeta correlates inversely with the hydrophobicity of the phospholipid substrate.
25429648 sPLA2 are secreted from ciliated cells and appear to induce mucin and cysLT secretion from goblet cells, strongly suggesting that airway goblet cells are proinflammatory effector cells.
25422234 Co-expression of PLA2G2A and COX-2 significantly correlated with the depth of invasion (p=0.004)and with TNM stage (p=0.04) of esophageal squamous cell carcinoma
25398877 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrin alphaVbeta3, integrin alphavbeta1, and integrin alpha4beta1.
25366587 PLA2G2A was detected in all samples of endometriomas, but not in normal endometrium, and immunohistochemistry showed PLA2G2A-specific staining in epithelial cells of endometrioma paraffin sections.
25347447 AdPLA2 plays an important role in promoting tumorigenesis and disease progression by modulating the production of prostaglandins and may serve as a potential therapeutic target in TSC and LAM.
25317799 Secretory PLA2 IIa expression can predict the clinical outcome of lung adenocarcinoma patients.
25290234 PLA2G2A levels increase in expectorations of cystic fibrosis patients in an age-dependent manner.
25286228 Studies indicate that the expression of secreted phospholipases A2 (sPLA2s), most notably the group IIA, III and X enzymes, is dysregulated in various malignant tissues.
25247183 Summarizing, Der p1 and Fel d1 involve phospholipase A2 enzymes in their action.
25082876 hydrolysis of the mitochondrial membrane by sPLA2-IIA yields inflammatory mediators (ie, lysophospholipids, fatty acids, and mtDNA) that promote leukocyte activation
24913497 Findings support the notion that sPLA2-IIa functions as a ligand for the EGFR family of receptors leading to an elevated HER/HER2-elicited signaling lung cancer cells.
24641411 PLA2G2A gene polymorphisms may modify the risk of esophageal squamous cell carcinoma development
24521628 women with metabolic syndrome demonstrated a low but positive correlation between sPLA2 and hsCRP levels
24508801 Data indicate that the expression of genes encoding hGIIA, hGIII and hGX sPLA2s (PLA2G2A, PLA2G3 and PLA2G10, respectively) in breast tumour biopsies differs from that in normal tissues.
24269828 two of these isoforms, sPLA2 IIA and sPLA2 IIF, localize to the upper stratum granulosum and increase in response to experimental barrier perturbation.
24115030 In a humanized triple transgenic mouse model with hypercholesterolemia, sPLA2-IIA inhibition increases CETP activity via increasing the very low-density lipoprotein-apoE content, resulting in a proatherogenic lipoprotein profile.
24113843 This review presents evidence for pathophysiological roles of sPLA2 in the central nervous system and neurological diseases.
24061501 Increased serum levels of serum amyloid a, PLA2G2, and C reactive protein were observed in patients with benign prostate hyperplasia, localized and metastasized prostate cancer in comparison to healthy individuals.
23901095 Studied the role of human sPLA2-IIA, a bactericidal enzyme induced during acute inflammation, in innate immunity against GBS, and show clinical GBS isolates are highly sensitive to killing by sPLA2-IIA but not by human antimicrobial peptides.
23883784 Secretory phospholipase A2 activity is raised in acute respiratory distress syndrome infants.
23852891 PLA2G2A may be a useful therapeutic target for a subset of gastric cancers
23722320 Determined circulating levels of sPLA2-IIA, C-reactive protein (CRP), fibrinogen, factor VIII (FVIII), von Willebrand factor (vWF), and antithrombin as biomarkers of inflammation and coagulation in patients with various types of malignancies.
23664539 Group IIA phospholipase A2 expression is an independent predictor of favorable outcome for patients with gastric cancer.
23609358 PLA2G2A expression inversely correlated with pathological classification.
23482564 an association between vimentin, hGIIA, and arachidonic acid metabolism in synovial inflammation.
23451150 Plasma PLA2 activities had approximately 70% specificity and sensitivity to detect cancer
23438648 Halogenated phospholipids are not the sPLA2 substrates. Halogenated phospholipids inhibit the sPLA2 activity.
23343574 Hydrophobic residues Leu2, Val3, Ala18, Leu19, Phe23, Gly30, and Phe63 that form the edge of the entrance of the hydrophobic binding pocket in PLA2 tend to penetrate into the hydrophobic area of lipid bilayers.
23079010 Knockdown of secretory PLA2 IIa suppresses lung cancer growth in part by attenuating NF-kappaB activity.
23026567 Baseline sPLA(2)IIa expression predicts response to sPLA(2)IIa inhibition in some K-ras mutant lung cancer cells.
22989727 membrane oxidation has a role in controlling the activity of human group IIa secretory phospholipase A(2) toward apoptotic lymphoma cells
22406427 The data obtained indicate that sPLA(2)IIA may contribute to the pathogenesis of neurodegenerative diseases involving neuroinflammation
22331023 mRNA expressionsof the gene encoding sPLA2G2A are significantly higher in recurrent depressive disorder than in controls.
22266334 Investigation into the role of phosphatidylserine in modifying the susceptibility of lymphocytes to secretory phospholipase A(2) using cells deficient in the expression of scramblase.
22173044 sPLA2-mediated hydrolysis of surfactant phospholipid, especially phosphatidylglycerol (PG) by PLA2G2A, contributes to surfactant injury during early acute respiratory distress syndrome (ARDS).
22127954 High levels of plasma secretory PLA2-IIa may serve as a tumor prognostic biomarker capable of distinguishing aggressive from indolent prostate cancers.
22075700 Human sPLA2-IIA contributes to the host defense against serious experimental S. pyogenes infection, providing a novel example of a bacterial resistance mechanism involved in protection against S. pyogenes infections in humans.
22056971 Lp-PLA(2) antigen but not activity is significantly associated with faster rates of kidney function decline
22042222 stimulated platelets are major contributors to plasma sPLA2 activity in vivo and account to a large extent for the adverse modification of circulating lipoproteins
21884198 PLA2G2A may predict survival and might be a potential biomarker for early detection and individualized therapy.
21848517 This study shows that T cells and antibodies may show cross-reactivity between different species without being naturally exposed to sPLA2s.
21813137 This study found that patients with TLE-MTS and psychosis had a significantly increased calcium-independent PLA(2) activity as compared to patients without psychosis
21799821 genetic polymorphisms, determination of serum sPLA(2)-IIa, and prognosis in coronary heart disease patients
21544859 Inhibitory effect of thrombin on the expression of secretory group IIA phospholipase A2
21455584 These data revealed that Vav3 overexpression as an additional underlying mechanism contributes to elevated sPLA2-IIa expression in prostate cancer
21417548 Multiple phospholipase A2 enzymes participate in the inflammatory process in osteoarthritic cartilage.
21404895 sPLA2-IIA, CRP, and C3d are significantly more activated in atherosclerotic aortic valves compared to degeneratively changed aortic valves.
21382622 Serum sPLA(2) activity has a role in abdominal aortic aneurysm (AAA) in men with small AAAs but is not associated with AAA progression
21255140 sPLA(2) -IIA and sPLA(2) -X are the major sPLA(2) s in human airways, and suggest a link between the levels of sPLA(2) -X in the airways and several features of asthma.
21099324 Data suggests that secretory sPLA2 IIA may be expressed in islets during insulitis, but not expressed in islets without insulitis.
21068383 A bifunctional role for group IIA secreted phospholipase A2 in human rheumatoid fibroblast-like synoviocyte arachidonic acid metabolism.
21042565 The content of sPLA2-IIa in tears of seasonal allergic conjunctivitis and perennial allergic conjunctivitis patients was elevated.
20837598 Secretory PLA2-IIa overexpression is associated with prostate development and progression
20812222 results suggest that the tumor cell iPLAbeta-lysophosphatidic acid axis may represent a novel target for prostate cancer
20639215 This study showed that sPLA(2)-IIA is able to bring into play EGFR to trigger its signaling
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600872 Data show that PLAforms could serve as markers of the immunity status in ARDS.
20463618 Observational study of gene-disease association. (HuGE Navigator)
20432503 Secretory PLA2 plays a novel anti-inflammatory role in rheumatoid arthritis
20357262 Group IIA secreted phospholipase A2 induces production of VEGF-A and VEGF-C in lung macrophages by a receptor-mediated, catalytically independent mechanism and may play an important role in inflammatory and neoplastic angiogenesis and lymphangiogenesis.
20061576 Data indicate that PLA2G2A does not contribute to the reduced reverse cholesterol transport observed during acute phase responses; PLA2G2A does contribute to reduced cholesterol efflux toward plasma.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20008021 Secretory type II phospholipase A2 is produced and secreted by epicardial adipose tissue and overexpressed in patients with coronary artery disease.
19962957 The antibacterial activity of phospholipase A(2) type IIA is regulated by the cooperative lipid chain melting behavior in Staphylococcus aureus
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850087 sPLA(2)-IIA and TNFalpha transduction pathways interact to modulate inflammatory responses and provide additional insights about the capacity of sPLA(2)-IIA to promote apoptosis resistance in astrocytoma cells.
19818633 this review highlights the potential role of the IIA PLA2 in resolving inflammatory situations involving both catalytic (antibacterial) and non-catalytic (debris removal) functions.[Review]
19798476 End-stage renal disease patients show increased formation of COX2-derived prostaglandins (p < 0.05) correlated with plasma sPLA2 (r = 0.71, p < 0.05).
19692168 Observational study of gene-disease association. (HuGE Navigator)
19647092 Native and oxidized lipoproteins regulate catalytic activity of sPLA(2)(IIA).
19625176 Observational study of gene-disease association. (HuGE Navigator)
19621421 analysis of the molecular mechanism of human group IIA phospholipase A2 inactivation by bolinaquinone
19495570 Observational study of gene-disease association. (HuGE Navigator)
19449149 Secretory phospholipase A2 was found to be associated with degree of severity of coronary artery disease.
19306380 sPLA(2)-IIA may be an important mediator of oligodendrocyte death and a novel target for therapeutic intervention following spinal cord injury
19276398 Quantification of PLA2 expression seems to provide valuable prognostic information in stage II CRC, particularly in selecting the patients at high risk for recurrent disease who might benefit from adjuvant therapy.
19245588 PLA2-IIA expression is increased in carcinoma when compared with benign prostate but decreased in metastatic cancers.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169647 These results demonstrate that suramin selectively inhibits the activity of the hsPLA(2) GIIA against macrophages, whilst leaving the anti-bacterial function unchanged.
19065693 Petrosaspongiolide M (PM) reacts with group IIA phospholipase A(2) Lys67 residue and covalently modifies the enzyme through imine formation. PM targets the active site of the enzyme through several van der Waals/electrostatic complementarities.
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18848929 Data show that serum concentrations of PLA(2)-IIA, Lp(a), ICAM-1 and PECAM-1 are higher for patients with unstable rather that stable angina and controls, and that high plasma Lp(a) is an independent risk factor for angina.
18827909 The role of sPLA2-IIA in the perpetuation of atherosclerosis appears to be the missing link between inflammation, activated renin-angiotensin system and lipid peroxidation.
18755682 sPLA(2)-IIA induces the differentiation of mononuclear cells and increases their adhesive and migratory capabilities, which suggests a novel function for sPLA(2)-IIA as a mediator connecting innate and adaptive immunity.
18752058 Overexpression of phospholipase 2A is associated with prostate cancer.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18635536 integrins alphavbeta3 and alpha4beta1 may serve as receptors for sPLA2-IIA and mediate pro-inflammatory action of sPLA2-IIA
18540439 Human cardiac myxoma exhibits highly positive phospholipase A2, group IIA, immunophenotype (100% positive cases).
18519687 results highlight the complexity of PLA2G2A regulation and provide functional evidence for PLA2G2A as an important regulator of invasion and metastasis in gastric cancer
18508504 Current knowledge about the various links of sPLA2-IIA to cancer of the gastro-intestinal tract, and several models to illustrate its putative biological effects on tumor development.[REVIEW]
18192373 These data demonstrated that interactions with sPLA(2) observed in artificial bilayers apply to biological membranes.
18089561 The enzyme produced supramolecular aggregates with anionic phospholipid vesicles as a result of bridging between particles, a property that is unique to this globally cationic IIA PLA2.
18037706 increased flux of cholesterol from HDL into the liver via SR-BI as a result of PLA2G2A modification of the HDL particle translates neither into increased biliary and fecal sterol output nor into increased gallstone formation
17936881 Activatted protein C(APC) effectively suppresses up-regulated sPLA(2)-IIA expressionwhich might contribute to the reported beneficial effects of APC in the treatment of severe inflammatory disorders.
17932742 sPLA2-IIa activity may serve a dual role in breast carcinogenesis, beneficial in its release of arachidonate and detrimental in the metabolic conversion of arachadonic acid into prostaglandins and leukotrienes.
17892360 This enzyme may be a useful guide for therapeutic efficacy and cardiovascular risk assessment. [REVIEW]
17565722 Intercellular PLA2 expression and location in human macrophages: influence of synthetic material surface chemistry are reported.
17545304 Observational study of gene-disease association. (HuGE Navigator)
17545304 sPLA2-IIA tSNP haplotypes do not show association with total and LDL cholesterol and oxLDL/LDL
17447002 Mean platelet PLA(2) activity was increased in individuals with Alzheimer's disease,vascular dementia and stroke.
17264305 Analysis of the lipid extracts of supernatants and cell pellets as well as pharmacological studies with calpeptin and the cytosolic phospholipase A2 (PLA2) inhibitor pyrrolidine-1 showed the dependence of AA release on cytosolic PLA2-catalyzed reactions.
17164967 Phospholipase A2 Group IIa may be a modifier gene for fundic gland polyposis in patients with familial adenomatous polyposis
17029400 large differences in activities result from distinct conformational changes in PLA(2)s upon membrane binding
16617059 cPLA2beta3 is a novel variant localized to mitochondria and early endosomes
16603549 cytosolic and group IIA secreted phospholipases A(2) work together to liberate arachidonate from phospholipids in response to cytokines
16585943 This study reviews the evidence and discusses the potential roles of phospholipase A2 Group 2A for schizophrenia with particular emphasis on published association studies.
16461407 A mechanism is indicated for phospholipase A2 type IIa (PLA2-IIA) to target perturbed native membranes with low global anionic lipid contents.
16368710 Observational study of gene-disease association. (HuGE Navigator)
16368710 PLA2G2A haplotypic variation strongly impacts on phospholipase A(2)IIa levels which are related to higher risk of coronary artery disease in patients with Type II diabetes mellitus.
16278219 increased sPLA(2) activity in inflammation in the presence of cells that have lost their membrane phospholipid asymmetry can lead to LPA-mediated endothelial dysfunction and loss of vascular integrity
16253130 Group IIA PLA2 is the major antibacterial factor in human acute phase serum against the gram-positive bacteria Staphylococcus aureus and Listeria monocytogenes, exceeding complement in efficiency
16177112 Appreciable bacterial phospholipid degradation occurs only in the presence of catalytically active group IIA-phospholipase A2 and a functional respiratory burst NADPH oxidase in neutrophils.
15964894 sPLA2-IIA expression occurred at higher levels in cystic fibrosis cells than in control cells
15897607 macrophage-specific overexpression of human sPLA2 increases atherogenesis by directly modulating foam cell formation and in vivo oxidative stress without any effect on systemic sPLA2 activity and lipoprotein metabolism
15802623 new autocrine and paracrine pathways activating sPLA2-IIA gene expression in rat and human vascular smooth muscle cells
15576846 macrophage sPLA2 IIa is a proatherogenic factor and regulates collagen production in the plaque
15318030 Observational study of gene-disease association. (HuGE Navigator)
15007070 Stable expression of human groups IIA and X secreted phospholipases A(2) (hGIIA and hGX) in CHO-K1 and HEK293 cells leads to serum- and interleukin-1beta-promoted arachidonate release.
14639048 Observational study of gene-disease association. (HuGE Navigator)
14499668 sPLA2-triggered release of fatty acids from erythrocyte membranes is inhibited by phospholipase A2-activating protein
12773489 hIIA PLA2 releases arachidonic acid from apoptotic T cells through interactions with heparan sulfate proteoglycans.
12694401 sPLA2-IIA potentiates the influx of Ca2+ into neurons via L-VSCC; eicosanoids and ROS generated during arachidonic acid oxidative metabolism are involved in sPLA2-IIA-induced apoptosis in cooperation with Ca2+
12626587 Group IIA secretory PLA2 induces the release of specific granule enzyme beta-glucuronidase, the production of IL-6 and IL-8, and the expression of activation markers (CD44 and CD69) on human eosinophils.
12574380 Human group IIA PLA2 induces expression of inducible nitric oxide synthase and nitrite production in a dose- and time-dependent manner in activated macrophages of mouse cell line Raw264.7.
12501175 The crystal structure of H48Q PLA2 reveals that the active site structure is maintained intact in the mutant and suggests a mechanism in which it is not essential to involve a base (His-48) to deprotonate a water molecule in order to facilitate catalysis.
12456890 The activity of PLA2G2A may suppress progression or metastasis of human gastric cancer.
12359734 the potent antistaphylococcal activity of Group IIA PLA(2) depends on cationic properties of the enzyme that promote binding to the cell wall
12244093 determination of binding site preference for membranes with anionic phospholipids
12085323 antibacterial properties of PLA2-IIA in human acute phase serum
11903045 Ceramides increase the activity of the secretory phospholipase A2 and alter its fatty acid specificity
11839587 data are consistent with the contention that group IIA sPLA2 expression is elevated in neoplastic prostatic tissue and support the hypothesis that dysregulation of sPLA2 may play a role in prostatic carcinogenesis
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence

MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC      1 - 70
YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS     71 - 140
TPRC                                                                      141 - 144
//

Text Mined References (176)

PMID Year Title
26644377 2015 Interleukin-22-Induced Antimicrobial Phospholipase A2 Group IIA Mediates Protective Innate Immunity of Nonhematopoietic Cells against Listeria monocytogenes.
26506412 2015 Deficiency of Calcium-Independent Phospholipase A2 Beta Induces Brain Iron Accumulation through Upregulation of Divalent Metal Transporter 1.
26488172 2015 sPLA2-IIA Augments Oxidized LDL-Induced MCP-1 Expression in Vitro Through Activation of Akt.
26106157 2015 Platelet microparticles are internalized in neutrophils via the concerted activity of 12-lipoxygenase and secreted phospholipase A2-IIA.
25794429 2015 The association of PLA2G2A single nucleotide polymorphisms with type IIa secretory phospholipase A2 level but not its activity in patients with stable coronary heart disease.
25713085 2015 Substrate efflux propensity is the key determinant of Ca2+-independent phospholipase A-? (iPLA?)-mediated glycerophospholipid hydrolysis.
25429648 2015 Secretory phospholipases A2 are secreted from ciliated cells and increase mucin and eicosanoid secretion from goblet cells.
25422234 2014 Overexpression of phospholipase A2 Group IIA in esophageal squamous cell carcinoma and association with cyclooxygenase-2 expression.
25398877 2015 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins ?v?3, ?4?1, and ?5?1.
25366587 2015 Phospholipase A2 group IIA is elevated in endometriomas but not in peritoneal fluid and serum of ovarian endometriosis patients.
25347447 2014 Rapamycin-insensitive up-regulation of adipocyte phospholipase A2 in tuberous sclerosis and lymphangioleiomyomatosis.
25317799 2014 Group IIa secretory phospholipase A2 (sPLA2IIa) and progression in patients with lung cancer.
25290234 2014 Pseudomonas aeruginosa eradicates Staphylococcus aureus by manipulating the host immunity.
25286228 2014 Secreted phospholipases A2 in cancer: diverse mechanisms of action.
25247183 2014 The step further to understand the role of cytosolic phospholipase A2 alpha and group X secretory phospholipase A2 in allergic inflammation: pilot study.
25082876 2014 Platelets release mitochondria serving as substrate for bactericidal group IIA-secreted phospholipase A2 to promote inflammation.
24913497 2014 Secretory phospholipase A2-IIa upregulates HER/HER2-elicited signaling in lung cancer cells.
24641411 2014 Association of single nucleotide polymorphisms in the prostaglandin-endoperoxide synthase 2 (PTGS2) and phospholipase A? group IIA (PLA2G2A) genes with susceptibility to esophageal squamous cell carcinoma.
24521628 2013 Role of secretory phospholipase A? in women with metabolic syndrome.
24508801 2014 Secreted phospholipases A?are differentially expressed and epigenetically silenced in human breast cancer cells.
24269828 2014 sPLA2 and the epidermal barrier.
24115030 2013 Expression of type IIA secretory phospholipase A2 inhibits cholesteryl ester transfer protein activity in transgenic mice.
24113843 2014 The role of secretory phospholipase A? in the central nervous system and neurological diseases.
24061501 2013 Serum amyloid A, phospholipase A?-IIA and C-reactive protein as inflammatory biomarkers for prostate diseases.
23901095 2013 Secreted group IIA phospholipase A2 protects humans against the group B streptococcus: experimental and clinical evidence.
23883784 2013 Clinical and biological role of secretory phospholipase A2 in acute respiratory distress syndrome infants.
23852891 2013 Knockdown of PLA2G2A sensitizes gastric cancer cells to 5-FU in vitro.
23722320 2013 Plasma levels of phospholipase A2-IIA in patients with different types of malignancies: prognosis and association with inflammatory and coagulation biomarkers.
23664539 2013 Expression of group IIA phospholipase A2 is an independent predictor of favorable outcome for patients with gastric cancer.
23609358 2013 Clinical significance of phospholipase A2 group IIA (PLA2G2A) expression in primary resected esophageal squamous cell carcinoma.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23482564 2013 Selective inhibition of human group IIA-secreted phospholipase A2 (hGIIA) signaling reveals arachidonic acid metabolism is associated with colocalization of hGIIA to vimentin in rheumatoid synoviocytes.
23451150 2013 Elevated phospholipase A2 activities in plasma samples from multiple cancers.
23438648 Halogenated phospholipids regulate secretory phospholipase A2 group IIA activity.
23343574 2013 Interaction of human synovial phospholipase A2 with mixed lipid bilayers: a coarse-grain and all-atom molecular dynamics simulation study.
23164706 2013 Identification of inhibitors against interaction between pro-inflammatory sPLA2-IIA protein and integrin ?v?3.
23079010 2012 Knockdown of secretory phospholipase A2 IIa reduces lung cancer growth in vitro and in vivo.
23026567 2012 Group IIa secretory phospholipase expression correlates with group IIa secretory phospholipase inhibition-mediated cell death in K-ras mutant lung cancer cells.
22989727 2013 Role of membrane oxidation in controlling the activity of human group IIa secretory phospholipase A(2) toward apoptotic lymphoma cells.
22837859 Group V phospholipase A(2) increases pulmonary endothelial permeability through direct hydrolysis of the cell membrane.
22406427 2012 Secreted phospholipase A(2) group IIA is a neurotoxin released by stimulated human glial cells.
22331023 2012 The expression of genes encoding for COX-2, MPO, iNOS, and sPLA2-IIA in patients with recurrent depressive disorder.
22266334 2012 Investigation into the role of phosphatidylserine in modifying the susceptibility of human lymphocytes to secretory phospholipase A(2) using cells deficient in the expression of scramblase.
22173044 2012 Secretory phospholipase A2-mediated depletion of phosphatidylglycerol in early acute respiratory distress syndrome.
22127954 2012 Secretory phospholipase A2-IIa is a target gene of the HER/HER2-elicited pathway and a potential plasma biomarker for poor prognosis of prostate cancer.
22075700 2011 A novel bacterial resistance mechanism against human group IIA-secreted phospholipase A2: role of Streptococcus pyogenes sortase A.
22056971 2011 Kidney function decline in the elderly: impact of lipoprotein-associated phospholipase A(2).
22042222 2012 Activated platelets contribute to oxidized low-density lipoproteins and dysfunctional high-density lipoproteins through a phospholipase A2-dependent mechanism.
21884198 2011 Phospholipase A2 group IIA expression correlates with prolonged survival in gastric cancer.
21848517 2011 T-cell and antibody responses to phospholipase A2 from different species show distinct cross-reactivity patterns.
21813137 2011 Increased PLA2 activity in the hippocampus of patients with temporal lobe epilepsy and psychosis.
21799821 2011 Type II secretory phospholipase A2 and prognosis in patients with stable coronary heart disease: mendelian randomization study.
21544859 2011 Inhibitory effect of thrombin on the expression of secretory group IIA phospholipase A?.
21455584 2011 Vav3 oncogene is involved in regulation of secretory phospholipase A2-IIa expression in prostate cancer.
21417548 2011 Multiple phospholipase A2 enzymes participate in the inflammatory process in osteoarthritic cartilage.
21404895 2011 Degeneration and atherosclerosis inducing increased deposition of type IIA secretory phospholipase A2, C-reactive protein and complement in aortic valves cause neutrophilic granulocyte influx.
21382622 2011 Serum secreted phospholipase A2 is associated with abdominal aortic aneurysm presence but not progression.
21255140 2011 Relationship between levels of secreted phospholipase A? groups IIA and X in the airways and asthma severity.
21099324 Expression of secretory phospholipase A 2 in insulitis of human transplanted pancreas and its insulinotropic effect on isolated rat islets.
21068383 2011 A bifunctional role for group IIA secreted phospholipase A2 in human rheumatoid fibroblast-like synoviocyte arachidonic acid metabolism.
21042565 2010 Quantification of tear proteins and sPLA2-IIa alteration in patients with allergic conjunctivitis.
20837598 2010 Secretory phospholipase A2-IIa is involved in prostate cancer progression and may potentially serve as a biomarker for prostate cancer.
20812222 2011 Tumor cell group via phospholipase A? is involved in prostate cancer development.
20639215 2010 Secreted PLA2 induces proliferation in astrocytoma through the EGF receptor: another inflammation-cancer link.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600872 2010 Impaired phospholipases A?production by stimulated macrophages from patients with acute respiratory distress syndrome.
20463618 2010 Role of polymorphic variants as genetic modulators of infection in neonatal sepsis.
20432503 2010 A novel anti-inflammatory role for secretory phospholipase A2 in immune complex-mediated arthritis.
20357262 2010 Production of vascular endothelial growth factors from human lung macrophages induced by group IIA and group X secreted phospholipases A2.
20061576 2010 Myeloperoxidase and serum amyloid A contribute to impaired in vivo reverse cholesterol transport during the acute phase response but not group IIA secretory phospholipase A(2).
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20008021 2010 Secretory type II phospholipase A2 is produced and secreted by epicardial adipose tissue and overexpressed in patients with coronary artery disease.
19962957 2010 The antibacterial activity of phospholipase A(2) type IIA is regulated by the cooperative lipid chain melting behavior in Staphylococcus aureus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850087 2009 Inflammatory protein sPLA(2)-IIA abrogates TNFalpha-induced apoptosis in human astroglioma cells: Crucial role of ERK.
19818633 2010 Catalytic and non-catalytic functions of human IIA phospholipase A2.
19798476 2010 Increased type IIA secretory phospholipase A(2) expression contributes to oxidative stress in end-stage renal disease.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19647092 2009 Opposite effects of native and oxidized lipoproteins on the activity of secretory phospholipase A(2) group IIA.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19621421 The molecular mechanism of human group IIA phospholipase A2 inactivation by bolinaquinone.
19495570 2009 Molecular and functional characterization of polymorphisms in the secreted phospholipase A2 group X gene: relevance to coronary artery disease.
19449149 2010 Secretory phospholipase A2 in patients with coronary artery disease.
19306380 2009 Differential expression of sPLA2 following spinal cord injury and a functional role for sPLA2-IIA in mediating oligodendrocyte death.
19276398 2009 PLA2 (group IIA phospholipase A2) as a prognostic determinant in stage II colorectal carcinoma.
19245588 2009 Group IIA phospholipase A as a prognostic marker in prostate cancer: relevance to clinicopathological variables and disease-specific mortality.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169647 2009 Suramin inhibits macrophage activation by human group IIA phospholipase A2, but does not affect bactericidal activity of the enzyme.
19065693 2009 The binding mode of petrosaspongiolide M to the human group IIA phospholipase A(2): exploring the role of covalent and noncovalent interactions in the inhibition process.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18848929 2008 Circulating secretory type IIA phospholipase A2, lipoprotein (a) and soluble cellular adhesion molecule levels in patients with angina pectoris.
18827909 2008 The secretory phospholipase A2 group IIA: a missing link between inflammation, activated renin-angiotensin system, and atherogenesis?
18755682 2009 Secreted phospholipase A2 type IIA as a mediator connecting innate and adaptive immunity: new role in atherosclerosis.
18752058 2009 Overexpression of CD24, c-myc and phospholipase 2A in prostate cancer tissue samples obtained by needle biopsy.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18635536 2008 Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.
18540439 [Phospholipase A2, group IIa, as an earlier unknown immunohistological marker of cardiac myxoma].
18519687 2008 Inhibition of gastric cancer invasion and metastasis by PLA2G2A, a novel beta-catenin/TCF target gene.
18508504 2008 The roles of sPLA2-IIA (Pla2g2a) in cancer of the small and large intestine.
18192373 2008 Effects of cholesterol on physical properties of human erythrocyte membranes: impact on susceptibility to hydrolysis by secretory phospholipase A2.
18089561 2008 A catalytically independent physiological function for human acute phase protein group IIA phospholipase A2: cellular uptake facilitates cell debris removal.
18037706 2008 Secretory phospholipase A2 increases SR-BI-mediated selective uptake from HDL but not biliary cholesterol secretion.
17936881 2008 On interaction of activated protein C with human aortic smooth muscle cells attenuating the secretory group IIA phospholipase A2 expression.
17932742 2008 Nipple aspirate fluids from women with breast cancer contain increased levels of group IIa secretory phospholipase A2.
17892360 2007 Lipoprotein-associated phospholipase A2: a new biomarker for cardiovascular risk assessment and potential therapeutic target.
17565722 2008 Intracellular phospholipase A2 expression and location in human macrophages: influence of synthetic material surface chemistry.
17545304 2007 Tagging SNP haplotype analysis of the secretory PLA2-V gene, PLA2G5, shows strong association with LDL and oxLDL levels, suggesting functional distinction from sPLA2-IIA: results from the UDACS study.
17447002 2007 Platelet phospholipase A2 activity in patients with Alzheimer's disease, vascular dementia and ischemic stroke.
17264305 2007 Peptidoglycan and mannose-based molecular patterns trigger the arachidonic acid cascade in human polymorphonuclear leukocytes.
17164967 2007 Impact of Phospholipase A2 group IIa gene polymorphism on phenotypic features of patients with familial adenomatous polyposis.
17069818 2007 Angiotensin II type 1-receptor antagonism prevents type IIA secretory phospholipase A2-dependent lipid peroxidation.
17029400 2006 Structural and functional effects of tryptophans inserted into the membrane-binding and substrate-binding sites of human group IIA phospholipase A2.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16617059 2006 Identification of the expressed form of human cytosolic phospholipase A2beta (cPLA2beta): cPLA2beta3 is a novel variant localized to mitochondria and early endosomes.
16603549 2006 Intracellular actions of group IIA secreted phospholipase A2 and group IVA cytosolic phospholipase A2 contribute to arachidonic acid release and prostaglandin production in rat gastric mucosal cells and transfected human embryonic kidney cells.
16585943 2006 The role of phospholipases A2 in schizophrenia.
16461407 2006 Domain-induced activation of human phospholipase A2 type IIA: local versus global lipid composition.
16381901 2006 The LIFEdb database in 2006.
16368710 2006 Tagging-SNP haplotype analysis of the secretory PLA2IIa gene PLA2G2A shows strong association with serum levels of sPLA2IIa: results from the UDACS study.
16278219 2006 Hydrolysis of phosphatidylserine-exposing red blood cells by secretory phospholipase A2 generates lysophosphatidic acid and results in vascular dysfunction.
16253130 2005 Roles of group IIA phospholipase A2 and complement in killing of bacteria by acute phase serum.
16177112 2005 Synergy between extracellular group IIA phospholipase A2 and phagocyte NADPH oxidase in digestion of phospholipids of Staphylococcus aureus ingested by human neutrophils.
15964894 2005 Impact of CFTR DeltaF508 mutation on prostaglandin E2 production and type IIA phospholipase A2 expression by pulmonary epithelial cells.
15897607 2005 Macrophage-specific expression of group IIA sPLA2 results in accelerated atherogenesis by increasing oxidative stress.
15802623 2005 Autocrine and paracrine transcriptional regulation of type IIA secretory phospholipase A2 gene in vascular smooth muscle cells.
15576846 2005 Macrophage-specific overexpression of group IIa sPLA2 increases atherosclerosis and enhances collagen deposition.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15318030 2004 Allelic association analysis of phospholipase A2 genes with schizophrenia.
15259375 2004 Presence of secretory group IIa and V phospholipase A2 and cytosolic group IValpha phospholipase A2 in chondrocytes from patients with rheumatoid arthritis.
15007070 2004 Arachidonic acid release from mammalian cells transfected with human groups IIA and X secreted phospholipase A(2) occurs predominantly during the secretory process and with the involvement of cytosolic phospholipase A(2)-alpha.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14639048 2003 Genetic association between the phospholipase A2 gene and unipolar affective disorder: a multicentre case-control study.
14499668 2003 Bimodal regulatory effect of melittin and phospholipase A2-activating protein on human type II secretory phospholipase A2.
12773489 2003 Interaction of low molecular weight group IIA phospholipase A2 with apoptotic human T cells: role of heparan sulfate proteoglycans.
12694401 2003 Human group IIA secretory phospholipase A2 potentiates Ca2+ influx through L-type voltage-sensitive Ca2+ channels in cultured rat cortical neurons.
12626587 2003 Secretory phospholipases A2 activate selective functions in human eosinophils.
12616631 2003 D-Tyrosine as a chiral precusor to potent inhibitors of human nonpancreatic secretory phospholipase A2 (IIa) with antiinflammatory activity.
12574380 2003 Akt as a mediator of secretory phospholipase A2 receptor-involved inducible nitric oxide synthase expression.
12501175 2002 The crystal structure of the H48Q active site mutant of human group IIA secreted phospholipase A2 at 1.5 A resolution provides an insight into the catalytic mechanism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456890 2002 Phospholipase A2 group IIA expression in gastric adenocarcinoma is associated with prolonged survival and less frequent metastasis.
12359734 2002 Role of charge properties of bacterial envelope in bactericidal action of human group IIA phospholipase A2 against Staphylococcus aureus.
12244093 2002 On the binding preference of human groups IIA and X phospholipases A2 for membranes with anionic phospholipids.
11752212 2002 Human group IIA secretory phospholipase A2 induces neuronal cell death via apoptosis.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10771478 2000 Identification of two secreted phospholipases A2 in human epidermis.
10747008 2000 Molecular basis for the association of group IIA phospholipase A(2) and decorin in human atherosclerotic lesions.
9848887 1998 Phospholipase A2 type II binds to extracellular matrix biglycan: modulation of its activity on LDL by colocalization in glycosaminoglycan matrixes.
9811056 1998 Interleukin-1alpha and tumor necrosis factor alpha synergistically stimulate prostaglandin E2-dependent production of interleukin-11 in rheumatoid synovial fibroblasts.
9695991 1998 Effects of long-term ursodeoxycholate administration on expression levels of secretory low-molecular-weight phospholipases A2 and mucin genes in gallbladders and biliary composition in patients with multiple cholesterol stones.
9538252 1998 Crystal structure of human secretory phospholipase A2-IIA complex with the potent indolizine inhibitor 120-1032.
9272153 1997 Loss of the PLA2G2A gene in a sporadic colorectal tumor of a patient with a PLA2G2A germline mutation and absence of PLA2G2A germline alterations in patients with FAP.
9155583 1997 Gene expression of group II phospholipase A2 in intestine in ulcerative colitis.
9032461 1997 High specificity of human secretory class II phospholipase A2 for phosphatidic acid.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838795 1996 Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.
8824283 1996 Binding of human phospholipase A2 type II to proteoglycans. Differential effect of glycosaminoglycans on enzyme activity.
8399335 1993 Purification and characterization of a phospholipase A2 from human ileal mucosa.
8175726 1994 Diversity of group types, regulation, and function of phospholipase A2.
7781071 1995 The secretory phospholipase A2 gene is a candidate for the Mom1 locus, a major modifier of ApcMin-induced intestinal neoplasia.
7721806 1995 The human 180-kDa receptor for secretory phospholipases A2. Molecular cloning, identification of a secreted soluble form, expression, and chromosomal localization.
7664108 1995 Structure-based design of the first potent and selective inhibitor of human non-pancreatic secretory phospholipase A2.
3240982 1988 Amino acid composition and NH2-terminal amino acid sequence of human phospholipase A2 purified from rheumatoid synovial fluid.
3202859 1988 Phospholipase A2 from human synovial fluid: purification and structural homology to the placental enzyme.
2925633 1989 Structure and properties of a human non-pancreatic phospholipase A2.
2925608 1989 Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.
2775276 1989 The primary structure of a membrane-associated phospholipase A2 from human spleen.
2708461 1989 Novel gene exon homologous to pancreatic phospholipase A2: sequence and chromosomal mapping of both human genes.
2239446 1990 Structure and properties of a secretable phospholipase A2 from human platelets.
2062381 1991 Structure of recombinant human rheumatoid arthritic synovial fluid phospholipase A2 at 2.2 A resolution.
2046470 1991 Enzymatic activity and distribution of phospholipase A2 in human cartilage.
1948070 1991 Structures of free and inhibited human secretory phospholipase A2 from inflammatory exudate.