Property Summary

Ligand Count 162
NCBI Gene PubMed Count 184
PubMed Score 743.33
PubTator Score 1041.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Carcinoma of colon 32

Expression

 OMIM Phenotype (1)

 MGI Phenotype (1)

 GWAS Trait (1)

PDB (18)

Gene RIF (149)

AA Sequence

MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC      1 - 70
YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS     71 - 140
TPRC                                                                      141 - 144
//

Text Mined References (186)

PMID Year Title