Property Summary

NCBI Gene PubMed Count 27
PubMed Score 90.17
PubTator Score 24.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.236 1.3e-02
esophageal adenocarcinoma 1.400 2.2e-02
group 3 medulloblastoma -2.700 2.1e-03
atypical teratoid / rhabdoid tumor -1.300 3.5e-05
medulloblastoma, large-cell -2.800 3.9e-06
primitive neuroectodermal tumor -1.200 3.8e-03
Atopic dermatitis -1.300 4.4e-03
adrenocortical carcinoma -1.195 1.6e-02
non-small cell lung cancer -1.679 6.5e-10
lung cancer -1.800 5.9e-05
active Crohn's disease 1.953 9.0e-03
breast carcinoma -1.300 1.2e-02
fibroadenoma -1.700 2.1e-02
adult high grade glioma -1.200 3.8e-02
non primary Sjogren syndrome sicca 1.200 2.5e-02
lung adenocarcinoma -1.100 3.9e-04
psoriasis -1.300 1.0e-04
lung carcinoma -1.200 4.8e-22
progressive supranuclear palsy -1.300 6.6e-03
ductal carcinoma in situ -2.700 3.0e-04
invasive ductal carcinoma -2.400 6.8e-03
ulcerative colitis 1.300 8.0e-03
ovarian cancer 1.200 8.2e-03
Down syndrome 1.300 7.1e-04

Synonym

Accession P53816 B2R7Q4 B7XAK5 Q3SYI3 Q9HDD1 HRSL3
Symbols AdPLA
HRSL3
HRASLS3
HREV107
HREV107-1
HREV107-3
H-REV107-1

Gene

PDB

2KYT   4DOT   4FA0   4Q95  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (14)

PMID Text
26381418 our results revealed that H-rev107 is also involved in lipid accumulation in liver cells through the POR pathway via its PLA2 activity.
26018079 suggest a novel regulatory mechanism for peroxisome biogenesis through the interaction between Pex19p and PLA/AT-3
25993412 Results show that osteosarcoma patients with metastasis showed higher expression of PLA2G16 at both the mRNA and protein levels and shorter overall survival suggesting it as significant prognostic factor for poor outcome.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25383759 crystal structure of the HRASLS3-LRAT chimeric enzyme in a thioester catalytic intermediate state revealed a major structural rearrangement accompanied by three-dimensional domain swapping dimerization not observed in native HRASLS
25024203 several mutant p53 proteins bind the Pla2g16 promoter at E26 transformation-specific (ETS) binding motifs and knockdown of ETS2 suppressed mutant p53 induction of Pla2g16.
24884338 Our study further suggests that the PLA/AT activity of H-rev107 may play an important role in H-rev107-mediated RAS suppression.
22923616 an alternate mechanism for AdPLA in promoting adipose tissue lipolysis that is not contingent on the release of arachidonic acid and that is compatible with its combined PLA(1)/A(2) activity
22605381 Data show that acyl-modified forms of HRAS-like tumor suppressors HRASLS2 and HRASLS3 mimicking lipolytic activity of lecithin retinol acyltransferase LRAT.
20501645 role of PKC isoenzymes in PP2A and HRSL3(H-REV107-1) tumor suppressor-dependent cell death induction in ovarian carcinoma cell line; verified contribution to PP2A- and HRLS3-dependent apoptosis for PKCzeta suggesting a proapoptotic function of this kinase
19136964 AdPLA ablation increases lipolysis and prevents obesity induced by high-fat feeding or leptin deficiency.
18614531 Identification and functional characterization of adipose-specific phospholipase A2 (AdPLA)
17003497 H-REV107-1 is deficient in its function as a tumor suppressor in non-small cell lung carcinomas.
12054741 Contact inhibition of growth and growth arrest caused by histone deacetylase inhibitors probably use the same mechanism to stimulate H-rev107 expression via histone acetylation in NIH3T3 cells

AA Sequence

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG      1 - 70
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA     71 - 140
GMGLAAMSLIGVMFSRNKRQKQ                                                    141 - 162
//

Text Mined References (29)

PMID Year Title
26381418 2015 H-rev107 Regulates Cytochrome P450 Reductase Activity and Increases Lipid Accumulation.
26018079 2015 Interaction of Phospholipase A/Acyltransferase-3 with Pex19p: A POSSIBLE INVOLVEMENT IN THE DOWN-REGULATION OF PEROXISOMES.
25993412 2015 PLA2G16 Expression in Human Osteosarcoma Is Associated with Pulmonary Metastasis and Poor Prognosis.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25416956 2014 A proteome-scale map of the human interactome network.
25383759 2015 LRAT-specific domain facilitates vitamin A metabolism by domain swapping in HRASLS3.
25024203 2014 Pla2g16 phospholipase mediates gain-of-function activities of mutant p53.
24884338 2014 Phospholipase A/Acyltransferase enzyme activity of H-rev107 inhibits the H-RAS signaling pathway.
22923616 2012 Structure/function relationships of adipose phospholipase A2 containing a cys-his-his catalytic triad.
22605381 2012 Structural basis for the acyltransferase activity of lecithin:retinol acyltransferase-like proteins.
20837014 2010 Solution structure of the N-terminal catalytic domain of human H-REV107--a novel circular permutated NlpC/P60 domain.
20501645 2010 Atypical protein kinase C zeta exhibits a proapoptotic function in ovarian cancer.
20100577 2010 Expression, purification and biochemical characterization of the N-terminal regions of human TIG3 and HRASLS3 proteins.
19615464 2009 Characterization of the human tumor suppressors TIG3 and HRASLS2 as phospholipid-metabolizing enzymes.
19136964 2009 AdPLA ablation increases lipolysis and prevents obesity induced by high-fat feeding or leptin deficiency.
18614531 2008 Identification and functional characterization of adipose-specific phospholipase A2 (AdPLA).
17374643 2007 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells.
17003497 2006 H-REV107-1 stimulates growth in non-small cell lung carcinomas via the activation of mitogenic signaling.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054741 2002 Induction of murine H-rev107 gene expression by growth arrest and histone acetylation: involvement of an Sp1/Sp3-binding GC-box.
11973642 2002 The class II tumour suppressor gene H-REV107-1 is a target of interferon-regulatory factor-1 and is involved in IFNgamma-induced cell death in human ovarian carcinoma cells.
11526504 2001 hH-Rev107, a class II tumor suppressor gene, is expressed by post-meiotic testicular germ cells and CIS cells but not by human testicular germ cell tumors.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9771974 1998 Transcriptional and translational downregulation of H-REV107, a class II tumour suppressor gene located on human chromosome 11q11-12.