Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.61
PubTator Score 15.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma -1.400 3.8e-05
medulloblastoma, large-cell -1.900 1.2e-05
tuberculosis 1.200 4.1e-05
diabetes mellitus -1.200 4.0e-03
posterior fossa group B ependymoma -1.100 2.0e-06
ovarian cancer 1.500 1.3e-06

Gene RIF (6)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19461040 Patients with transient ischemic atack have a high-risk mechanism (large vessel stenosis or cardioembolism) or will experience stroke/death within 90 days. In contrast to CRP, both Lp-PLA(2) mass and activity were associated with this composite end point.
18983494 analyzed the association of five polymorphisms (-1357G>A, -403T>C, Arg92His, Ile198Thr, Ala379Val) and related haplotypes at the PLA2G7 locus with angiographic coronary artery disease, plasma LpPLA2 activity, and long-term survival
14754907 The RXR agonist methoprene acid worked as well as all-trans-retinoic acid at increasing both lysosomal phospholipase A2 mRNA and enzyme activity

AA Sequence

MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE      1 - 70
SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT     71 - 140
MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR    141 - 210
QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK    211 - 280
VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR    281 - 350
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP            351 - 412
//

Text Mined References (27)

PMID Year Title
25727495 2015 Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23958596 2013 Role of N-glycosylation of human lysosomal phospholipase A2 for the formation of catalytically active enzyme.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20410020 2010 The measurement of lysosomal phospholipase A2 activity in plasma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19461040 2009 Lipoprotein-associated phospholipase A2 and C-reactive protein for risk-stratification of patients with TIA.
18983494 2009 Genetic variants and haplotypes of lipoprotein associated phospholipase A2 and their influence on cardiovascular disease (The Ludwigshafen Risk and Cardiovascular Health Study).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16973413 2006 The phospholipase A2 superfamily and its group numbering system.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14754907 2004 Induction of lysosomal phospholipase A2 through the retinoid X receptor in THP-1 cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790796 2002 Cloning and characterization of a lysosomal phospholipase A2, 1-O-acylceramide synthase.
10395961 1999 Mammalian lysophospholipases.
10230407 1999 ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity.
10092508 1999 Cloning and expression of a novel lysophospholipase which structurally resembles lecithin cholesterol acyltransferase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.