1. Home
  2. Targets
  3. Group XIIB secretory phospholipase A2-like protein

Tdark Group XIIB secretory phospholipase A2-like protein

Not known; does not seem to have catalytic activity.

The protein encoded by this gene belongs to the phospholipase A2 (PLA2) group of enzymes, which function in glycolipid hydrolysis with the release of free fatty acids and lysophospholipids. This family member has altered phospholipid-binding properties and is catalytically inactive. The protein is secreted, and together with microsomal triglyceride transfer protein, it functions to regulate HNF4alpha-induced hepatitis C virus infectivity. The expression of this gene is down-regulated in various tumors, suggesting that it may function as a negative regulator of tumor progression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.01
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 2.7e-02
pancreatic ductal adenocarcinoma liver m... -2.581 1.9e-03
ulcerative colitis -2.200 6.1e-06

Synonym

Accession Q9BX93 B7ZL23 Q52LB2 Q96Q99
Symbols GXIIB
FKSG71
PLA2G13
GXIIIsPLA2
sPLA2-GXIIB

Gene

PLA2G12B

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Function (2)

 GO Component (1)

 GO Process (3)

 Compartment GO Term (3)

 MGI Phenotype (2)

 HCA RNA Cell Line (27)

See all...

Pathway (10)

Protein-protein Interaction (1)

CCPG1  

Gene RIF (3)

PMID Text
19817957 Observational study of gene-disease association. (HuGE Navigator)
9745929 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor
9377118 HIV-1 gp120 causes an activation of phospholipase A2, resulting in the increased release of arachidonic acid, which may sensitize the NMDA receptor

AA Sequence 

MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRY      1 - 70
GKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSI     71 - 140
CSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL                   141 - 195
//

Text Mined References (14)

PMID Year Title
25201034 2014 Gene profiling of human VEGF signaling pathways in human endothelial and retinal pigment epithelial cells after anti VEGF treatment.
24173221 2014 Hepatocyte nuclear factor 4? and downstream secreted phospholipase A2 GXIIB regulate production of infectious hepatitis C virus.
22909802 2012 Conservation of group XII phospholipase A2 from bacteria to human.
21274867 2011 Hepatocyte nuclear factor-4 alpha regulates liver triglyceride metabolism in part through secreted phospholipase A? GXIIB.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19541351 2009 Lung mast cells are a source of secreted phospholipases A2.
18212756 2008 Distinct expression pattern of the full set of secreted phospholipases A2 in human colorectal adenocarcinomas: sPLA2-III as a biomarker candidate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15863368 2005 Time-resolved fluoroimmunoassays of the complete set of secreted phospholipases A2 in human serum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14516201 2003 Novel mammalian group XII secreted phospholipase A2 lacking enzymatic activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.