Property Summary

NCBI Gene PubMed Count 35
PubMed Score 24.33
PubTator Score 27.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.700 9.1e-07
esophageal adenocarcinoma -1.900 4.7e-02
psoriasis 2.400 2.4e-06
Atopic dermatitis 1.100 5.2e-04
pancreatic ductal adenocarcinoma liver m... 2.102 7.8e-04
non-small cell lung cancer 1.518 1.7e-17
interstitial cystitis -1.300 5.9e-04
lung adenocarcinoma 1.600 1.2e-08
invasive ductal carcinoma 1.100 1.7e-02
ovarian cancer 1.200 1.8e-08
pituitary cancer -1.300 3.2e-03

Gene RIF (23)

PMID Text
26872154 Children with low 25-hydroxyvitamin D and TMEM16J rs7111432-AA or PKP3 rs10902158-GG polymorphisms were at increased risk for tuberculosis or death.
25972099 Data suggest juxtamembrane regions/domains of desmocollin-2 (DSC2), plakophilin 2 (PKP2), and plakophilin 3 (PKP3) are involved in desmosome formation in epithelial cells; DSC2 participates in desmosome formation in absence of desmoglein 2 (DSG2).
25875355 The results suggest that MMP7 over-expression may be one of the mechanisms by which PKP3 loss leads to increased cell invasion and tumor formation.
25501895 reactive oxygen species (ROS) trigger the c-Src kinase-mediated tyrosine (Tyr)-195 phosphorylation of PKP3.
25225333 cytoplasmic PKP1/3 are components of mRNA ribonucleoprotein particles and act as posttranscriptional regulators of gene expression.
25208567 These findings reveal Pkp3 as a coordinator of desmosome and adherens junction assembly and maturation through its functional association with Rap1.
24328683 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3.
24178805 The study describes a new protein variant of the human PKP3 gene, namely PKP3b, which differs from the published PKP3a only at the amino-terminus by the splicing in of the newly identified exon 1b.
24124604 stratifin plays a role in regulating plakophilin-3 incorporation into the desmosomal plaque by forming a plakophilin-3 stratifin complex in the cytosol and thereby affecting desmosome dynamics in squamous epithelial cells.
22701666 Plakophilin3 loss leads to an increase in PRL3 levels promoting K8 dephosphorylation, which is required for transformation and metastasis.
22223854 These results demonstrate a strong association of single-nucleotide polymorphisms in the PKP3-SIGIRR-TMEM16J gene region and tuberculosis in discovery and validation cohorts.
21947748 In breast cancer, compared with normal tissue, PKP1 and PKP2 expressions were indifferent (P > 0.05), but PKP3 expression was significantly increased
21194493 loss of PKP3 expression during gastric adenocarcinoma progression may indicate an invasive phenotype.
20859650 plakoglobin and E-cadherin recruit plakophilin3 to the cell border to initiate desmosome formation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20501752 PKP3 mRNA can be used as a marker of subclinical disease in gastrointestinal cancer and thus holds potential clinical relevance as a predictor for disease outcome
20348237 both loss of PKP1 and up-regulation of PKP3 expression are biologically important events in prostate cancer and are associated with a more aggressive phenotype
19913121 Observational study of gene-disease association. (HuGE Navigator)
18801625 qRT-PCR assay targeted to plakophilin 3 and anterior gradient-2 mRNAs might be helpful to detect circulating tumor cells in patients with gastrointestinal cancer.
18729189 plakophilin3 loss leads to a decrease in cell-cell adhesion leading to the stimulation of neoplastic progression and metastasis
17391671 The transcriptional repression of PKP3 by ZEB1 contributes to ZEB1-mediated disintegration of intercellular adhesion and epithelial to mesenchymal transition.
16407409 Cytoplasmic PKP3 is constitutively associated with RNA-binding proteins and indicate an involvement in processes of translation and RNA metabolism.
12707304 PKP3, whose desmosomal expression and protein interactions are broader than those of PKP1 and -2, is a unique multiprotein binding element in many epithelial desmosomes.

AA Sequence

MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQPRHNGAAEPE      1 - 70
PEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWSSRSAVDLSCSRRLSSAHNGG     71 - 140
SAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTY    141 - 210
RAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPS    211 - 280
VRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSD    281 - 350
AAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR    351 - 420
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATGFLRNLSSASQ    421 - 490
ATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYDEMPPSALQRLEGRGRRDLAG    491 - 560
APPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLEWLWSPQIVGLYNRLLQRCELNRHTTEAAAG    561 - 630
ALQNITAGDRRWAGVLSRLALEQERILNPLLDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHL    631 - 700
IEKLPGSVGEKSPPAEVLVNIIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSL    701 - 770
LANLWQYNKLHRDFRAKGYRKEDFLGP                                               771 - 797
//

Text Mined References (44)

PMID Year Title
26872154 2016 Low Vitamin-D Levels Combined with PKP3-SIGIRR-TMEM16J Host Variants Is Associated with Tuberculosis and Death in HIV-Infected and -Exposed Infants.
25972099 2015 Desmocollin-2 alone forms functional desmosomal plaques, with the plaque formation requiring the juxtamembrane region and plakophilins.
25875355 2015 MMP7 is required to mediate cell invasion and tumor formation upon Plakophilin3 loss.
25501895 2015 c-Src mediated tyrosine phosphorylation of plakophilin 3 as a new mechanism to control desmosome composition in cells exposed to oxidative stress.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25225333 2014 Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins.
25208567 2014 Plakophilin 3 mediates Rap1-dependent desmosome assembly and adherens junction maturation.
24328683 2014 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of plakophilin 3 and its detachment from desmoglein 3.
24178805 2014 An alternative promoter of the human plakophilin-3 gene controls the expression of the new isoform PKP3b.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24124604 2013 Stratifin (14-3-3 ?) limits plakophilin-3 exchange with the desmosomal plaque.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23136403 2013 Mutations in the area composita protein ?T-catenin are associated with arrhythmogenic right ventricular cardiomyopathy.
22701666 2012 Plakophilin3 loss leads to an increase in PRL3 levels promoting K8 dephosphorylation, which is required for transformation and metastasis.
22223854 2012 Common polymorphisms in the PKP3-SIGIRR-TMEM16J gene region are associated with susceptibility to tuberculosis.
21947748 2012 Expression of Plakophilins (PKP1, PKP2, and PKP3) in breast cancers.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21194493 2011 Expression of plakophilins (PKP1, PKP2, and PKP3) in gastric cancers.
20859650 2011 E-cadherin and plakoglobin recruit plakophilin3 to the cell border to initiate desmosome assembly.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20501752 2010 Evaluation of plakophilin-3 mRNA as a biomarker for detection of circulating tumor cells in gastrointestinal cancer patients.
20348237 2010 Desmosomal plakophilins in the prostate and prostatic adenocarcinomas: implications for diagnosis and tumor progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18801625 2008 Bioinformatics approach to mRNA markers discovery for detection of circulating tumor cells in patients with gastrointestinal cancer.
18729189 2008 Plakophilin3 downregulation leads to a decrease in cell adhesion and promotes metastasis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17391671 2007 The transcription factor ZEB1 (deltaEF1) represses Plakophilin 3 during human cancer progression.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16407409 2006 Identification of the junctional plaque protein plakophilin 3 in cytoplasmic particles containing RNA-binding proteins and the recruitment of plakophilins 1 and 3 to stress granules.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12827610 2003 Immunohistochemical localization of plakophilins (PKP1, PKP2, PKP3, and p0071) in primary oropharyngeal tumors: correlation with clinical parameters.
12707304 2003 Defining desmosomal plakophilin-3 interactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10852826 2000 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis.
10381383 1999 Plakophilin-3, a novel armadillo-like protein present in nuclei and desmosomes of epithelial cells.
10374265 1999 Plakophilin 3--a novel cell-type-specific desmosomal plaque protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.