Property Summary

NCBI Gene PubMed Count 45
PubMed Score 76.25
PubTator Score 86.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -2.000 2.1e-06
esophageal adenocarcinoma -2.100 1.8e-02
interstitial cystitis -1.600 1.7e-02
non-small cell lung cancer 2.224 1.6e-10
psoriasis 2.300 2.5e-07
spina bifida -1.110 2.2e-02

 GWAS Trait (1)

Gene RIF (28)

AA Sequence

MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSSTLSHSNRGSM      1 - 70
YDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGA     71 - 140
GSDICFMQKIKASRSEPDLYCDPRGTLRKGTLGSKGQKTTQNRYSFYSTCSGQKAIKKCPVRPPSCASKQ    141 - 210
DPVYIPPISCNKDLSFGHSRASSKICSEDIECSGLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAK    211 - 280
QQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQL    281 - 350
TGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRKRLGMRELL    351 - 420
ALVPQRATSSRVNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEV    421 - 490
PTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSK    491 - 560
KDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHR    561 - 630
VMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKA    631 - 700
AEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF                           701 - 747
//

Text Mined References (46)

PMID Year Title