Property Summary

NCBI Gene PubMed Count 36
PubMed Score 52.74
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.4e-06
osteosarcoma 7933 6.2e-06
psoriasis 6685 2.7e-04
Disease Target Count Z-score Confidence
Down syndrome 548 3.067 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.000 2.7e-04
osteosarcoma -1.663 6.2e-06
group 4 medulloblastoma 1.800 1.4e-06

Gene RIF (11)

PMID Text
25157139 PREP1 modulates the cellular sensitivity to TGF-beta by inducing the small mothers against decapentaplegic homolog 3 (SMAD3) nuclear translocation.
22347417 Single nucleotide polymorphism in gene encoding transcription factor Prep1 is associated with HIV-1-associated dementia
22185299 High levels of MEIS1 and PREP1, and low levels of PBX4 expression were founded in samples of patients with ALL.
21715654 The tumor suppressor role of Prep1 is associated with the maintenance of genomic stability.
21203543 analysis of the regulatory region of the zebrafish Prep1.1 gene and the promoter of human PREP1
20106730 Immunohistochemistry on tissue micrroarrays (TMA) generated from three distinct human cohorts comprising a total of some 1000 human tumors revealed that 70% of the tumors express no or extremely low levels of Prep1, unlike normal tissues.
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18093541 Interleukin-10 expression in macrophages during phagocytosis of apoptotic cells is mediated by homeodomain proteins Pbx1 and Prep-1.
12871956 PREP-1 has a role in F9 teratocarcinoma cells: it causes an increase of PBX-2 by preventing its degradation
12771203 PKNOX1 gene-dosage imbalance is associated with overexpression of FABP7 in Down syndrome fetal brains.
12732210 PREP1 regulates PF4 gene expression.

AA Sequence

MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALL      1 - 70
FEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCK     71 - 140
DFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAITGTISPQGIVVPASALQQGNVAMATVAGGT    141 - 210
VYQPVTVVTPQGQVVTQTLSPGTIRIQNSQLQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQ    211 - 280
HIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSI    281 - 350
ASGVAQPPPSELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA    351 - 420
PAHISGLVLENSDSLQ                                                          421 - 436
//

Text Mined References (38)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
25157139 2014 Transcription factor PREP1 induces EMT and metastasis by controlling the TGF-?-SMAD3 pathway in non-small cell lung adenocarcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22347417 2012 Single nucleotide polymorphism in gene encoding transcription factor Prep1 is associated with HIV-1-associated dementia.
22185299 2011 MEIS1, PREP1, and PBX4 are differentially expressed in acute lymphoblastic leukemia: association of MEIS1 expression with higher proliferation and chemotherapy resistance.
21715654 2011 Homeodomain transcription factor and tumor suppressor Prep1 is required to maintain genomic stability.
21203543 2010 Characterization of the regulatory region of the zebrafish Prep1.1 gene: analogies to the promoter of the human PREP1.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20106730 2010 Prep1 (pKnox1)-deficiency leads to spontaneous tumor development in mice and accelerates EmuMyc lymphomagenesis: a tumor suppressor role for Prep1.
19559479 2010 MEIS proteins as partners of the TLX1/HOX11 oncoprotein.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
18093541 2007 Interleukin-10 expression in macrophages during phagocytosis of apoptotic cells is mediated by homeodomain proteins Pbx1 and Prep-1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15468914 2004 [Molecular cloning for an alternatively splicing cDNA of human PKNOX1 gene and it's expression analysis].
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12871956 2003 Overexpression of PREP-1 in F9 teratocarcinoma cells leads to a functionally relevant increase of PBX-2 by preventing its degradation.
12771203 2003 Overexpression of FABP7 in Down syndrome fetal brains is associated with PKNOX1 gene-dosage imbalance.
12732210 2003 PREP1, MEIS1 homolog protein, regulates PF4 gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342305 2000 TALE homeoproteins as HOX11-interacting partners in T-cell leukemia.
10906782 2000 Changes in HOXB6 homeodomain protein structure and localization during human epidermal development and differentiation.
10830953 2000 The DNA sequence of human chromosome 21.
10471746 1999 A conserved motif N-terminal to the DNA-binding domains of myogenic bHLH transcription factors mediates cooperative DNA binding with pbx-Meis1/Prep1.
10373562 1999 Trimeric association of Hox and TALE homeodomain proteins mediates Hoxb2 hindbrain enhancer activity.
10215622 1999 The subcellular localization of PBX1 and EXD proteins depends on nuclear import and export signals and is modulated by association with PREP1 and HTH.
9582372 1998 A conserved C-terminal domain in PBX increases DNA binding by the PBX homeodomain and is not a primary site of contact for the YPWM motif of HOXA1.
9482740 1998 The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.
9482739 1998 Prep1, a novel functional partner of Pbx proteins.
9479508 1998 PKNOX1, a gene encoding PREP1, a new regulator of Pbx activity, maps on human chromosome 21q22.3 and murine chromosome 17B/C.
9366523 1997 The chimeric oncoproteins E2A-PBX1 and E2A-HLF are concentrated within spherical nuclear domains.
9143494 1997 Cloning of a novel homeobox-containing gene, PKNOX1, and mapping to human chromosome 21q22.3.
9079695 1997 Distinct HOX N-terminal arm residues are responsible for specificity of DNA recognition by HOX monomers and HOX.PBX heterodimers.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7729685 1995 Pbx proteins display hexapeptide-dependent cooperative DNA binding with a subset of Hox proteins.