Property Summary

Ligand Count 1
NCBI Gene PubMed Count 28
PubMed Score 19.16
PubTator Score 13.53

Knowledge Summary

Patent (14,407)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Metabolic syndrome X 52 0.0 0.9
Disease Target Count Z-score Confidence
Western equine encephalitis 13 3.989 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.700 8.9e-07
breast carcinoma 2.200 3.4e-07
lung adenocarcinoma 1.600 5.8e-11
malignant mesothelioma 1.800 8.4e-07
medulloblastoma, large-cell 1.100 8.5e-05
non-small cell lung cancer 1.016 2.3e-20
psoriasis 1.200 5.8e-03

Synonym

Accession Q99640 B3KUN8 B4DXD4 D3DUA4 F8W164 I3L1V2 O14731 Q7LE24 Q8TCM9
Symbols MYT1
PPP1R126

Gene

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR      1 - 70
TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR     71 - 140
SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV    141 - 210
WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ    211 - 280
GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA    281 - 350
EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS    351 - 420
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS    421 - 490
LFEDTLDPT                                                                 491 - 499
//

Text Mined References (34)

PMID Year Title