Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.19
PubTator Score 13.53

Knowledge Summary

Patent (14,407)

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.800 8.4e-07
psoriasis 1.500 3.0e-30
medulloblastoma, large-cell 1.100 8.5e-05
non-small cell lung cancer 1.016 2.3e-20
breast carcinoma 2.200 3.4e-07
lung adenocarcinoma 1.600 5.8e-11
inflammatory breast cancer 3.100 9.7e-06

 GWAS Trait (1)

Protein-protein Interaction (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
23241949 Myt1 is inactivated by MEK1 mediated phosphorylation to fragment the Golgi complex in G2 and for the entry of cells into mitosis.
18378775 The results show that Myt1-mediated suppression of Cdc2 activity is not indispensable for the regulation of a broad range of mitotic events but is specifically required for the control of intracellular membrane dynamics during mitosis in Hela cells.
16476973 overexpressed during the S phase of the cell cycle compared with the G0/1 phase
15175024 the induction of Cdc2 phosphorylation due to the increase of Wee1 and Myt1 as well as the reduction of Cdc2 and cyclin B1 are involved in 1,25[OH]2VD3-induced G2/M arrest of keratinocytes.
12738781 Myt1 is phosphorylated by polo-like kinase 1
12606722 MYT1 binds to TSAP6 in tumor cells and has a role in cell cycle regulation

AA Sequence

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPR      1 - 70
TPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKR     71 - 140
SMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQV    141 - 210
WGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQ    211 - 280
GSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA    281 - 350
EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS    351 - 420
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLS    421 - 490
LFEDTLDPT                                                                 491 - 499
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23397142 2013 Analysis of protein-protein interactions in cross-talk pathways reveals CRKL protein as a novel prognostic marker in hepatocellular carcinoma.
23241949 2013 MEK1 inactivates Myt1 to regulate Golgi membrane fragmentation and mitotic entry in mammalian cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22189141 2012 In vitro and in silico studies on substrate recognition and acceptance of human PKMYT1, a Cdk1 inhibitory kinase.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18378775 2008 Myt1 protein kinase is essential for Golgi and ER assembly during mitotic exit.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16476973 2006 Identifying cellular genes crucial for the reactivation of Kaposi's sarcoma-associated herpesvirus latency.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15175024 2004 Keratinocyte G2/M growth arrest by 1,25-dihydroxyvitamin D3 is caused by Cdc2 phosphorylation through Wee1 and Myt1 regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12738781 2003 Identification of a consensus motif for Plk (Polo-like kinase) phosphorylation reveals Myt1 as a Plk1 substrate.
12606722 2003 The p53-inducible TSAP6 gene product regulates apoptosis and the cell cycle and interacts with Nix and the Myt1 kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11802161 2002 Akt inhibits Myt1 in the signalling pathway that leads to meiotic G2/M-phase transition.
11326318 Microtubule-targeting drugs induce Bcl-2 phosphorylation and association with Pin1.
10504341 1999 The C-terminal domain of the Cdc2 inhibitory kinase Myt1 interacts with Cdc2 complexes and is required for inhibition of G(2)/M progression.
10373560 1999 Overproduction of human Myt1 kinase induces a G2 cell cycle delay by interfering with the intracellular trafficking of Cdc2-cyclin B1 complexes.
9499405 1998 The essential mitotic peptidyl-prolyl isomerase Pin1 binds and regulates mitosis-specific phosphoproteins.
9268380 1997 Human Myt1 is a cell cycle-regulated kinase that inhibits Cdc2 but not Cdk2 activity.
9001210 1997 The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex.