Property Summary

Ligand Count 12
NCBI Gene PubMed Count 288
PubMed Score 1424.21
PubTator Score 447.47

Knowledge Summary

Patent (72,928)


  Disease (4)


  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma 1.071 2.7e-03
adrenocortical carcinoma 2.004 1.1e-04
astrocytoma 1.500 2.5e-02
atypical teratoid / rhabdoid tumor 1.800 3.1e-06
breast carcinoma 1.100 4.7e-02
dermatomyositis -2.500 3.6e-04
ductal carcinoma in situ 1.400 3.9e-04
ependymoma 2.200 4.1e-03
glioblastoma 1.900 6.4e-05
group 4 medulloblastoma 1.200 3.4e-02
interstitial lung disease 1.100 3.5e-03
intraductal papillary-mucinous carcinoma... 1.900 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.3e-03
invasive ductal carcinoma 1.400 3.1e-04
lung adenocarcinoma 1.300 5.9e-08
lung cancer 1.800 2.3e-03
medulloblastoma, large-cell 1.600 8.6e-06
non-small cell lung cancer 1.284 1.4e-19
oligodendroglioma 1.600 3.7e-03
osteosarcoma -1.580 1.6e-03
ovarian cancer 1.500 1.0e-03
pancreatic cancer 1.500 6.0e-06
pancreatic ductal adenocarcinoma liver m... 2.954 6.1e-03
psoriasis -1.400 6.4e-04
Rheumatoid arthritis -1.300 4.4e-02
ulcerative colitis 1.400 7.8e-07

PDB (27)

Gene RIF (235)

AA Sequence

NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP                                 491 - 531

Text Mined References (309)

PMID Year Title