Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.10
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.154 5.6e-05
colon cancer -1.400 2.4e-02
cystic fibrosis -1.017 3.6e-05
intraductal papillary-mucinous adenoma (... -1.900 4.5e-05
intraductal papillary-mucinous carcinoma... -2.200 1.7e-04
intraductal papillary-mucinous neoplasm ... -2.600 5.4e-03
lung adenocarcinoma -1.500 1.2e-09
lung cancer -1.200 6.5e-03
malignant mesothelioma -2.100 2.0e-07
medulloblastoma -1.300 1.8e-05
medulloblastoma, large-cell -2.400 2.0e-04
non-small cell lung cancer -1.596 4.3e-18
ovarian cancer -2.400 1.3e-07
primitive neuroectodermal tumor -1.100 1.5e-03

Gene RIF (6)

AA Sequence

MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSS      1 - 70
DGTTSS                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title