Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.50
PubTator Score 10.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -2.800 4.5e-03
ependymoma -2.500 2.0e-02
oligodendroglioma -2.600 6.5e-03
cystic fibrosis 2.215 3.4e-05
atypical teratoid / rhabdoid tumor -2.000 2.1e-02
Atopic dermatitis -1.800 9.4e-05
ulcerative colitis -3.400 2.1e-06
breast carcinoma 1.500 5.7e-04
fibroadenoma 1.500 9.0e-03
interstitial cystitis 1.100 1.8e-02
non primary Sjogren syndrome sicca -1.600 2.1e-02
psoriasis -1.200 7.4e-19
subependymal giant cell astrocytoma -3.630 5.9e-03
lung adenocarcinoma 1.200 3.3e-03
lung carcinoma 3.000 1.2e-30
gastric carcinoma -1.500 2.9e-02
ductal carcinoma in situ 2.300 8.8e-03
ovarian cancer 1.100 2.0e-02
pituitary cancer -3.400 5.5e-06

Synonym

Accession Q9C010 B2RCK2 Q567T9 Q5T0Z7 PKI-beta
Symbols PRKACN2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
24869658 mutation of the pseudosubstrate domain abolished the inhibitory activity of PKIB on protein kinase A activity, but had no effect on the interaction with GPR39, cell protection and induction of SRE-dependent transcription
23224602 PKIB overexpression was strongly correlated with pAkt expression and triple-negative breast cancer, suggesting that PKIB overexpression might contribute to the tumor behavior and development of breast cancers.
19483721 Findings show that PKIB and PKA-C kinase can have critical functions of aggressive phenotype of PCs through Akt phosphorylation and that they should be a promising molecular target for PC treatment.
19460752 Knockdown of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19035091 PKIbeta may be a novel full-length gene related to human glioma and may provide a new way to gene therapy of glioma.
12061725 human PKIbeta gene (clone 436F11, GenBank with accession number: AF225513) was over-expressed in normal brain tissues
7684369 Functional studies of the mouse homolog
2052616 Functional studies of the rat homolog

AA Sequence

MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL      1 - 70
EKPQNEEK                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title
24869658 2014 Protein kinase inhibitor ? enhances the constitutive activity of G-protein-coupled zinc receptor GPR39.
23224602 2012 PKIB expression strongly correlated with phosphorylated Akt expression in breast cancers and also with triple-negative breast cancer subtype.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19035091 2008 [Expression and characterizations of a novel full-length gene PKIbeta related to human glioma].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12061725 2002 Isolation of novel differentially expressed genes related to human glioma using cDNA microarray and characterizations of two novel full-length genes.
11978406 2002 Protein inhibitor of neuronal nitric oxide synthase interacts with protein kinase A inhibitors.
10880337 2000 Cloning and mapping of human PKIB and PKIG, and comparison of tissue expression patterns of three members of the protein kinase inhibitor family, including PKIA.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7684369 1993 Evidence for two additional isoforms of the endogenous protein kinase inhibitor of cAMP-dependent protein kinase in mouse.
2052616 1991 Molecular cloning of a rat testis form of the inhibitor protein of cAMP-dependent protein kinase.