Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.07
PubTator Score 11.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.326 3.1e-02
adult high grade glioma -1.700 1.9e-03
astrocytic glioma -1.800 2.7e-02
Astrocytoma, Pilocytic -1.500 3.2e-04
atypical teratoid / rhabdoid tumor -2.000 3.7e-04
cystic fibrosis 4.226 2.0e-07
ependymoma -1.600 1.2e-04
glioblastoma -1.700 1.4e-04
head and neck cancer -1.300 7.7e-03
hereditary spastic paraplegia -1.313 1.0e-03
interstitial cystitis -1.200 1.2e-02
lung cancer -2.200 6.8e-04
malignant mesothelioma -2.900 2.1e-08
medulloblastoma, large-cell -1.700 8.6e-04
ovarian cancer -1.300 9.7e-04
subependymal giant cell astrocytoma -2.061 4.9e-02
ulcerative colitis 1.900 8.4e-06

PDB (84)

Gene RIF (1)

AA Sequence

MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE      1 - 70
AAKSES                                                                     71 - 76
//

Text Mined References (23)

PMID Year Title