Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.07
PubTator Score 11.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.326 3.1e-02
adult high grade glioma -1.700 1.9e-03
astrocytic glioma -1.800 2.7e-02
Astrocytoma, Pilocytic -1.500 3.2e-04
atypical teratoid / rhabdoid tumor -2.000 3.7e-04
cystic fibrosis 4.226 2.0e-07
ependymoma -1.600 1.2e-04
glioblastoma -1.700 1.4e-04
head and neck cancer -1.300 7.7e-03
hereditary spastic paraplegia -1.313 1.0e-03
interstitial cystitis -1.200 1.2e-02
lung cancer -2.200 6.8e-04
malignant mesothelioma -2.900 2.1e-08
medulloblastoma, large-cell -1.700 8.6e-04
ovarian cancer -1.300 9.7e-04
subependymal giant cell astrocytoma -2.061 4.9e-02
ulcerative colitis 1.900 8.4e-06

Synonym

Accession P61925 P04541 Q6IAV2 PKI-alpha
Symbols PRKACN1

Gene

PDB

3AMA   3AMB   3L9L   3L9M   3L9N   3MVJ   3NX8   3OOG   3OVV   3OWP   3OXT   3P0M   3POO   3VQH   4UJ1   4UJ2   4UJ9   4UJA   4UJB   4WB5   4WB6   4WB7   4WB8   5BX6   5BX7   5DH9   1CMK   1JLU   1Q8T   1VEB   1XH4   1XH5   1XH6   1XH7   1XH8   1XH9   1XHA   1YDR   2C1A   2C1B   2F7E   2GNI   2JDS   2JDT   2JDV   2L1L   2UVX   2UVY   2UVZ   2UW0   2UW3   2UW4   2UW5   2UW6   2UW7   2UW8   2VNW   2VNY   2VO0   2VO3   2VO6   2VO7   3WYG   3X2U   3X2V   3X2W   4AXA   4IAC   4IAD   4IAF   4IAI   4IAK   4IAY   4IAZ   4IB0   4IB1   4IB3   4IE9   4IJ9   4O21   4O22   4Z83   4Z84   5XOJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE      1 - 70
AAKSES                                                                     71 - 76
//

Text Mined References (23)

PMID Year Title