Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.59
PubTator Score 8.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.809 3.8e-04
osteosarcoma 2.332 6.9e-05
atypical teratoid / rhabdoid tumor -1.300 6.8e-04
medulloblastoma -1.100 8.8e-05
medulloblastoma, large-cell -1.500 2.3e-04
hereditary spastic paraplegia -1.428 8.9e-03
juvenile dermatomyositis 1.004 9.9e-07
Amyotrophic Lateral Sclerosis 1.149 1.2e-04
acute quadriplegic myopathy 1.101 2.6e-03
lung cancer -1.100 3.1e-03
colon cancer -1.300 2.4e-03
Parkinson's disease -1.500 1.2e-02
Breast cancer 3.600 3.7e-02
ovarian cancer -2.800 1.6e-08

Gene RIF (3)

PMID Text
23931849 Detection of PJA2-FER fusion mRNA is correlated with poor postoperative survival periods in non-small cell lung cancer.
23652010 The RING ligase praja2 ubiquitylates and degrades Mob, a core component of NDR/LATS kinase and a positive regulator of the tumour-suppressor Hippo cascade.
22948757 praja2 is a novel cancer-related gene whose expression is linked to the histotype and mutational status of the thyroid tumor.

AA Sequence

MSQYTEKEPAAMDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDD      1 - 70
VPKENSSGSSPLDQVDSSLPSEPIFEKSETEIPTCGSALNQTTESSQSFVAVHHSEEGRDTLGSSTNLHN     71 - 140
HSEGEYIPGACSASSVQNGIALVHTDSYDPDGKHGEDNDHLQLSAEVVEGSRYQESLGNTVFELENREAE    141 - 210
AYTGLSPPVPSFNCEVRDEFEELDSVPLVKSSAGDTEFVHQNSQEIQRSSQDEMVSTKQQNNTSQERQTE    211 - 280
HSPEDAACGPGHICSEQNTNDREKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREAL    281 - 350
EVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGATAGRQEVDNTFWNGCGDYYQ    351 - 420
LYDKDEDSSECSDGEWSASLPHRFSGTEKDQSSSDESWETLPGKDENEPELQSDSSGPEEENQELSLQEG    421 - 490
EQTSLEEGEIPWLQYNEVNESSSDEGNEPANEFAQPAFMLDGNNNLEDDSSVSEDLDVDWSLFDGFADGL    491 - 560
GVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDGLPETLVLEDHTAIGQ    561 - 630
EQCCPICCSEYIKDDIATELPCHHFFHKPCVSIWLQKSGTCPVCRRHFPPAVIEASAAPSSEPDPDAPPS    631 - 700
NDSIAEAP                                                                  701 - 708
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23931849 2013 Detection of novel paraja ring finger 2-fer tyrosine kinase mRNA chimeras is associated with poor postoperative prognosis in non-small cell lung cancer.
23652010 2013 Proteolysis of MOB1 by the ubiquitin ligase praja2 attenuates Hippo signalling and supports glioblastoma growth.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22948757 2012 Expression of the ring ligase PRAJA2 in thyroid cancer.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036302 2002 PJA1, encoding a RING-H2 finger ubiquitin ligase, is a novel human X chromosome gene abundantly expressed in brain.
11959851 2002 A RING finger protein Praja1 regulates Dlx5-dependent transcription through its ubiquitin ligase activity for the Dlx/Msx-interacting MAGE/Necdin family protein, Dlxin-1.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
9393880 1997 Praja1, a novel gene encoding a RING-H2 motif in mouse development.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7623148 1995 A novel RING-H2 motif protein downregulated by axotomy: its characteristic localization at the postsynaptic density of axosomatic synapse.