Property Summary

NCBI Gene PubMed Count 20
PubMed Score 481.44
PubTator Score 14.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

 GO Function (1)

Gene RIF (13)

PMID Text
26646899 Results show that three CpG loci within FYN were hypermethylated in obese individuals, while obesity was associated with lower methylation of CpG loci within PIWIL4 and TAOK3.
25038252 Immunoprecipitation of Hiwi2 from MDAMB231 cancer cells enriches for piRNAs that are predominantly derived from processed tRNAs and expressed genes.
24969058 study to evaluate frequency of PIWIL4 genetic variants in order to better define the relationship between PIWIL4 SNPs and defective spermatogenesis and specific spermatogenic disorders; results suggest genetic and epigenetic alterations that affect the PIWI pathway contribute to unsuccessful sperm production
24509249 associations were determined between the Piwi-like family member expression levels and clinicopathological parameters of ccRCC, suggesting a potential role for these genes/proteins in ccRCC diagnostics and tumorigenesis
24464225 Data suggest that MIWI2 and MIWI2-associated piRNAs have functions beyond TE suppression.
22748119 we identified a significant association between the expression of Piwi-like 2 and 4 mRNAs and the tumor-specific survival of soft tissue sarcoma patients.
22483988 PIWIL4 might play an oncogenic role in cervical cancer
20940137 An SNP in the 3'untranslated region of HIWI2 and a non-synonymous SNP in HIWI3 were significantly associated with an altered risk of oligozoospermia.
20940137 Observational study of gene-disease association. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20146808 EIF2C2-4 and PIWIL4 appear increased in advanced tumors with distant metastasis, suggesting they may promote tumor invasion
17544373 PIWIL4 plays important roles in the chromatin-modifying pathway in human somatic cells

AA Sequence

MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFM      1 - 70
ERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLR     71 - 140
IALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQRGETIKMTITLKRELPSSSPVCIQVFNIIF    141 - 210
RKILKKLSMYQIGRNFYNPSEPMEIPQHKLSLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTAL    211 - 280
CQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSD    281 - 350
LNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN    351 - 420
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLIL    421 - 490
CSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYD    491 - 560
SIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGIDVCKDALS    561 - 630
KDVMVVGCVASVNPRITRWFSRCILQRTMTDVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQL    631 - 700
KTLIEYEVPQLLSSVAESSSNTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYL    701 - 770
ISQVACRGTVSPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE    771 - 840
PSLELANHLFYL                                                              841 - 852
//

Text Mined References (21)

PMID Year Title
26646899 2015 Genome-wide methylation analysis identifies differentially methylated CpG loci associated with severe obesity in childhood.
25038252 2014 The human Piwi protein Hiwi2 associates with tRNA-derived piRNAs in somatic cells.
24969058 Association of PIWIL4 genetic variants with germ cell maturation arrest in infertile Spanish men.
24509249 2014 Piwi-like 1 and 4 gene transcript levels are associated with clinicopathological parameters in renal cell carcinomas.
24464225 2014 Conditional inactivation of Miwi2 reveals that MIWI2 is only essential for prospermatogonial development in mice.
22748119 2012 Expression of human Piwi-like genes is associated with prognosis for soft tissue sarcoma patients.
22483988 2012 PIWIL4 regulates cervical cancer cell line growth and is involved in down-regulating the expression of p14ARF and p53.
20940137 2010 Genetic variants in Piwi-interacting RNA pathway genes confer susceptibility to spermatogenic failure in a Chinese population.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20146808 2010 Argonaute proteins: potential biomarkers for human colon cancer.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17544373 2007 The induction of H3K9 methylation by PIWIL4 at the p16Ink4a locus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749716 2004 Characterization of the interactions between mammalian PAZ PIWI domain proteins and Dicer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12906857 2003 Identification of eight members of the Argonaute family in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414724 2002 The Argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis.