Property Summary

NCBI Gene PubMed Count 62
PubMed Score 314.85
PubTator Score 104.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 3.090 9.7e-03
Breast cancer 1.300 7.4e-06
breast carcinoma 1.700 5.4e-37
ductal carcinoma in situ 1.700 1.8e-02
esophageal adenocarcinoma -2.800 2.9e-02
fascioscapulohumeral muscular dystrophy 1.124 1.2e-03
invasive ductal carcinoma 1.800 4.6e-02
lung adenocarcinoma 1.300 3.0e-05
medulloblastoma, large-cell 1.900 1.2e-03
non-small cell lung cancer 3.209 9.1e-19
pancreatic cancer 1.200 6.2e-05
pituitary cancer 1.300 3.5e-06
psoriasis 1.700 6.7e-05
spina bifida -2.716 3.7e-02

Gene RIF (36)

AA Sequence

MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDS      1 - 70
GAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNR     71 - 140
RAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSS    141 - 210
QSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNS    211 - 280
SLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS                                        281 - 314
//

Text Mined References (65)

PMID Year Title