Property Summary

NCBI Gene PubMed Count 11
PubMed Score 23.76
PubTator Score 19.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -3.200 4.4e-05
astrocytic glioma -3.200 2.7e-03
Astrocytoma, Pilocytic -3.600 3.9e-09
atypical teratoid / rhabdoid tumor -4.200 1.6e-12
ependymoma -3.300 1.9e-03
glioblastoma -2.700 2.1e-07
group 3 medulloblastoma -2.600 9.9e-03
intraductal papillary-mucinous adenoma (... 1.500 6.4e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.4e-02
medulloblastoma, large-cell -4.000 7.0e-06
non primary Sjogren syndrome sicca -1.100 1.3e-02
oligodendroglioma -2.600 4.4e-03
ovarian cancer -1.700 8.8e-04
primitive neuroectodermal tumor -3.300 3.0e-05
psoriasis 1.300 1.2e-07
spina bifida -1.916 1.9e-02
subependymal giant cell astrocytoma -2.995 3.8e-02

Gene RIF (8)

AA Sequence

MAKAGRAGGPPPGGGAPWHLRNVLSDSVESSDDEFFDAREEMAEGKNAILIGMSQWNSNDLVEQIETMGK      1 - 70
LDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHVLLLVLHGGNIL     71 - 140
DTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSS    141 - 210
QDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAICYSA    211 - 280
GPSGDSPASSSRKGSISSTQDTPVAVEEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDC    281 - 350
EAITQHHAFLSSIHSSVLKDESETPAAGGPQLPEVSLGRFDFDVSDFFLFGSPLGLVLAMRRTVLPGLDG    351 - 420
FQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEG    421 - 490
SSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPD    491 - 560
VLTAFPTVALPHLFHASYWESTDVVAFILRQVMRYESVNIKESARLDPAALSPANPREKWLRKRTQVKLR    561 - 630
NVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEPSSGRWVHLDTEITNSSGRITYN    631 - 700
VPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRH    701 - 770
WQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYG    771 - 840
STKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAALEASHRSRPKKNNSRMILRKGSFGL    841 - 910
HAQPEFLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWARGPPKFESVP          911 - 974
//

Text Mined References (16)

PMID Year Title